KEGG   Kribbella flavida: Kfla_6081Help
Entry
Kfla_6081         CDS       T01155                                 

Definition
glycoside hydrolase family 3 domain-containing protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
kfl  Kribbella flavida
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:kfl00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Kfla_6081
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    Kfla_6081
Enzymes [BR:kfl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Kfla_6081
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6531156..6532955)
Genome map
AA seq 599 aa AA seqDB search
MSRPTRRTVLGLAAAAVAGAAGLRPGVAAASNPGRAHGWATATLARMTLEEKVGQLFVTY
AYGATAQTADRRNVTAYGVATPAEVVAKYKLGGVIYFAWTDSVANPPQIAALSNGLQQAS
LAVGDKVSVPLLISTDQEHGVVFRVGPPATQFPGAMALGAGRSTADAREAAAIAGAELRA
VGVNQAYAPVADVNVNALNPVIGVRSFSSDPTLVADLTAAQVTGLEGGGGIASCAKHFPG
HGDTVDDSHTSLPTINHTREQWNTIDAPPFEAAIEAGIDSIMTAHIVVPSLDPSGEPATL
SKPILTGILREQLGYDGVVITDSLAMAGVRQKYGDAEVAVRALEAGCDQLLMSPAMDVAY
NAVLAAVRSGRITEKRLDQSVYRVLRLKHLNGVVADPMVDVAAVPSVVGTPEHYAAAQRI
ADRTTTVVKNEAGLLPLSAGPRKVLVTGYGVSTTQTLANRLTARGATTTVRQTGATPSDT
AIAGAVAAARANDLTVVLTMKAWDTAVTDKQGKQQKLVKDLLATGKPVIVVAVRDPYDIA
YFTAAPTYLATYSYADVSMESLAKVLYGELKPAGKLPVDVPVAGSPATKLYPFGHGLTW
NT seq 1800 nt NT seq  +upstreamnt  +downstreamnt
gtgagccgtccgacccggcgtaccgtcctgggcctggctgcagcggctgttgccggtgcg
gccgggctccggcccggtgtcgccgccgcctcgaaccctggccgtgcccacggctgggcc
accgcgacgctggcgcggatgacgctggaggagaaggtcggccagcttttcgtcacctac
gcctacggcgccaccgcgcagaccgccgaccggcgcaacgtcacggcgtacggcgtcgcg
acgccggcggaggtggtggccaagtacaagctgggcggcgtcatctacttcgcctggacc
gactcggtcgccaacccgccgcagatcgccgcgctgtcgaacgggctgcagcaggcctcg
ctcgccgtcggtgacaaggtctcggtcccgctgctgatcagcaccgaccaggagcacggc
gtcgtgttccgggtcggtccgccggccacccagttcccgggcgcgatggcgctcggggcg
ggccgcagtacggccgacgcccgggaggccgcggcgatcgccggggcggagctgcgggcg
gtgggcgtcaaccaggcctacgcgccggtggccgacgtcaacgtgaacgcgctcaacccg
gtgatcggggtgcgttcgttctcgtccgaccccacgctggtcgccgacctgaccgcggcc
caggtgaccgggctggagggcggcggcggcatcgcctcgtgcgcgaagcacttcccgggg
cacggtgacaccgtcgacgacagccacacgtcgctgccgacgatcaaccacacccgcgag
cagtggaacacgatcgacgcgccgccgttcgaggccgcgatcgaggccgggatcgactcg
atcatgaccgcgcacatcgtggtgccgtcgctggatccgtccggcgagcccgccacgctg
agcaagccgattctgaccggcatcctgcgcgaacagctcggttacgacggcgtggtgatc
accgactcgctcgcgatggccggcgtccggcagaagtacggcgacgccgaggtggcggtg
cgcgcgctcgaagccggctgcgaccagttgctgatgtcgccggcgatggacgtcgcctac
aacgccgtgctggcggcggtccggtccggccggatcaccgagaagcggctcgaccagagc
gtctaccgggtcctgcggctgaagcacctcaacggtgtcgtcgccgacccgatggtcgac
gtcgcggccgtgccgtcggtggtcggaacgcccgagcactacgcggccgcgcaacgcatc
gccgaccggaccacgacagtggtgaagaacgaggcgggtctgctgccgctgagtgctggt
ccgcgcaaggtgctggtgaccgggtacggcgtgtccaccacccagacactcgccaaccgg
ttgaccgcgcgcggtgccacgacgaccgtgcgacagaccggtgcgacgccgtcggacacc
gcgatcgccggtgcggtcgcggctgcgcgcgccaacgacctgaccgtcgtcctgaccatg
aaggcctgggacaccgcggtcaccgacaagcagggcaagcagcagaagctggtcaaggac
ctgctcgcgaccggcaagccggtgatcgtggtcgccgtgcgcgacccgtacgacatcgcc
tacttcaccgccgcgccgacgtacctggccacctactcgtacgccgacgtgtcgatggag
tcgctcgccaaggtgctgtacggcgagctcaagccggccggcaagctgccggtcgacgtc
ccggtcgccgggtcgccggcgacgaagctctatccgttcgggcacgggctgacatggtga

DBGET integrated database retrieval system