KEGG   Kribbella flavida: Kfla_6374Help
Entry
Kfla_6374         CDS       T01155                                 

Definition
(GenBank) Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin) methyltransferase
  KO
K13542  uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
kfl  Kribbella flavida
Pathway
kfl00860  Porphyrin and chlorophyll metabolism
kfl01100  Metabolic pathways
kfl01110  Biosynthesis of secondary metabolites
kfl01120  Microbial metabolism in diverse environments
Module
kfl_M00121  Heme biosynthesis, glutamate => heme
kfl_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:kfl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Kfla_6374
Enzymes [BR:kfl01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     Kfla_6374
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Kfla_6374
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 TP_methylase
Motif
Other DBs
NCBI-ProteinID: ADB35374
UniProt: D2PWZ4
Position
complement(6829913..6831649)
Genome map
AA seq 578 aa AA seqDB search
MTPARGTTTAKNTSKTRAKATADVSSAKTAAATKTPQKVPAKVAAGSSTVKQTRPLGHVT
FVGVGPGDPALLTIAGRDVLANADAVVVEGPEHDPFLAYCRPGVEVVDGSGAEGSRALRI
AARARLVVKTAKASANVVRLLTGDPFTFSSGAEEAAACRKAGISFNVVPGVSEVSAVPAY
AGIPLTVKGEREVTVLDLAESKLDFSRLHPKQTLVLLNAVDVLKDTTVALVDAGFDAGTP
VAATVGGTTTAQTSVVGTLGTIVADLRAAKVTGPAVIVVGSVVEQRETLSWFETKPLFGW
RILVPRTKDQAGPLMDRLRRYGAMPEEVPTISVEPPRNPQQMDKAIRGLVEGRYEWVAFT
SVNAVKAVREKFDEYGLDARAFSGLKIAAVGEKTAEAIGAWGIRPDLLPSGEQSAAGLVE
DWPPFDEVLDPINRVFLPRADIATETLVAGLTDLGWEVDDVTAYRTVRAAPPPAPTREAI
KSGKFDAVVFTSSSTVRNLVGIAGKPHASTVIAVIGPATLKTAEEHGLRVDAMAESPSAE
ELADALARFGADRRDTMVEAGEPVTRPSERRSGSRRKS
NT seq 1737 nt NT seq  +upstreamnt  +downstreamnt
atgacaccggcacggggaacgacgacggccaagaacacgagcaagacgagggcgaaggcg
acggcagacgtgagcagcgcgaagacagcagcggccaccaagactccgcagaaggtgccg
gcgaaggtcgcggcggggtccagcacggtcaagcagaccaggccgctcggccacgtcacg
ttcgtcggcgtcggcccgggtgaccccgcgctgctgacgatcgccggccgcgacgtgctc
gcgaacgccgacgcggtggtggtcgaaggccccgagcacgacccgttcctggcgtactgc
cggccgggtgtcgaggtggtcgacggctccggcgccgagggcagccgggcgctgcggatc
gcggcccgggcccggctggtggtgaagaccgccaaggcctcggcgaacgtggtccggctg
ctgaccggtgacccgttcaccttctccagcggcgccgaggaggccgccgcctgccgcaag
gccgggatcagcttcaacgtggtgccgggggtcagcgaggtcagcgccgtaccggcgtac
gcgggcattccgctgacggtgaagggcgagcgcgaggtgaccgtgctcgacctggccgag
tccaagctcgacttcagccggctgcacccgaagcagacgctggtcctgctgaacgccgtg
gacgtgctcaaagacacgacggtcgcgctggtcgacgccggcttcgacgccggcacgccg
gtcgccgcgacggtcggcggcaccacgacggcgcagaccagcgtggtcggcacgctcggc
accatcgtcgcggacctgcgcgccgccaaggtgaccggcccggccgtgatcgtggtcggc
tcggtcgtcgagcagcgcgagacgctcagctggttcgagaccaagccgctgttcggctgg
cgcatcctggtgccgcgcaccaaggaccaggccggaccgctgatggaccggctgcgccgc
tacggcgcgatgccggaggaggtgccgaccatctcggtcgagccgccgcgcaacccgcag
cagatggacaaggcgatccgcggcctggtcgagggccgctacgagtgggtcgcgttcacc
tcggtgaacgcggtcaaggcggtccgggagaagttcgacgagtacggcctggacgcgcgt
gccttctccgggctgaagatcgccgccgtcggcgagaagaccgccgaggcgatcggcgcc
tggggcatccggccggacctgctgccctcgggtgagcagtccgccgccgggctggtcgag
gactggccgccgttcgacgaggtgctcgacccgatcaaccgggtcttcctgccgcgcgcg
gacatcgccaccgagacgctggtggccggcctgaccgatctcggctgggaggtcgacgac
gtcacggcgtaccggaccgtgcgggccgccccgccgcccgcgccgacccgcgaggcgatc
aagtcgggcaagttcgacgcggtcgtgttcacctcgtcctcgaccgtgcgcaacctggtc
ggcatcgccggcaagccgcacgcgtcgaccgtgatcgcggtgatcggcccggcgaccctg
aagaccgccgaggagcacggcctgcgcgtcgacgcgatggccgagtcgccgtccgccgag
gagctggccgacgctctcgcccggttcggcgcggaccggcgtgacacgatggtagaggcc
ggagaaccggtcacccgcccgtccgagcgccgctcgggctctcgcaggaagagctag

DBGET integrated database retrieval system