KEGG   Kribbella flavida: Kfla_6484Help
Entry
Kfla_6484         CDS       T01155                                 

Definition
Cholesterol oxidase (EC:1.1.3.6)
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
kfl  Kribbella flavida
Brite
KEGG Orthology (KO) [BR:kfl00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    Kfla_6484
Enzymes [BR:kfl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     Kfla_6484
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6940442..6942067
Genome map
AA seq 541 aa AA seqDB search
MTASNETNQSVVTRRRFAGLAAFTSAAALGLSRVGDAVAAERSFVPAVVVGTGYGAAVTA
LRLGEAGVATTMLEMGQPWNQPGADGKVFCSTLAPDRRSMWFHRRTAAPLDTFLWLDVVN
RDLGTPYAGVLDRIDFPAMDVYVGRGVGGGSLVNGGMAPTPRRSYFEQVLPRVDADQMYR
RWFPLANRMLGVNSIDPRYLETTPAYRYARVSRRHAHQAGFRTAVIPNVYDFGYLEQEER
RQVPRSALAGEVIYGNNHGKQSLDKTYLADAVGTGRVTIRTLTRVVSVRADRRGYVLGLE
QIDASGKVVRRSELGCRQLFLGAGSIGTTELLLRARETGTLPDLPDAIGEGWGTNGNVMT
ARANHAWDPTGSLQSTIPAVAIDNWDDPVHPAFAEIAPLPTGLETWAGLYLAITANPERG
RLSYDHATDRAILHWQASQSTPSIQAAKALFDRINRATGTTYRRDLFSGNRAFAADFCYH
PLGGCVLGRATDDYGRVRGHRNLYVTDSALLPGSIGVNPFVTITALAERNIARVIATDLT
R
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgcctccaacgagaccaaccagtccgtagtgacccgacgccggttcgccggcctc
gctgccttcacctccgccgccgctctcggcctgagccgggtcggcgacgccgtcgccgcc
gagcgctcgttcgttccggccgtcgtggtcggcaccggctacggcgcggccgtcaccgcg
ctgcgcctgggcgaggccggcgtcgcgacgacgatgctggagatgggccagccgtggaac
cagcccggcgccgacggcaaggtgttctgctcgaccctggcccccgaccgccgctcgatg
tggttccaccggcgcaccgcggcgccgctcgacacgttcctgtggctcgacgtggtcaac
cgcgacctcggtacgccgtacgccggagtgctggaccggatcgacttcccggccatggac
gtgtacgtcggccgcggggtcggcggcggatcgctggtcaacggcggcatggcgccgacg
ccgcggcggtcgtacttcgagcaggtgctgccgcgtgtcgacgcggaccagatgtaccgg
cgctggttcccgctggcgaaccggatgctcggggtgaactcgatcgatccgcgctacctg
gagacgaccccggcctaccgttacgcccgggtgtcccgccggcacgcccaccaggccggc
ttccgcaccgcggtgatcccgaacgtctacgacttcggctacctggagcaggaggagcgc
cggcaggtcccgcgatcggcgctggccggcgaggtcatctacggcaacaaccacggcaag
cagagcctcgacaagacctacctcgccgatgccgtcggcaccggccgggtgacgatccgg
acgctgaccagggtcgtctcggtccgcgcggaccgccgcggctacgttctcggcctcgag
cagatcgatgcctcgggcaaggttgttcggcgcagcgagctcggctgccggcagctgttc
ctcggcgccggcagcatcggcaccaccgagctgctgctgcgcgcccgggagaccggcacg
ctgcccgacctgccggacgcgatcggcgagggctggggaaccaacggcaacgtgatgacc
gctcgggcgaaccacgcctgggacccgaccggctcgctgcagtccaccatcccggccgtt
gccatcgacaactgggatgacccggtccacccggccttcgcggagatcgcgccgctgccg
acggggctggagacctgggccggtctgtacctggcgatcaccgccaaccccgagcgcggc
cggctgagctacgaccacgccaccgatcgggcgatcttgcactggcaggcgtcccagtcg
acgccgtcgatccaggccgcgaaggcgttgttcgaccggatcaaccgcgcgacgggcacg
acgtaccgtcgcgacctgttctccggcaaccgggcgttcgccgcggacttctgctaccac
ccgctcggcggctgcgtgctcggccgcgccaccgacgactacggccgggttcgcggccac
cgcaacctctacgtcaccgacagcgcgctgctgcccggatcgatcggcgtcaaccccttc
gtcaccatcaccgccctggccgagcgcaacatcgcccgggtgatcgccaccgacctcacc
cgctga

DBGET integrated database retrieval system