KEGG   Kribbella flavida: Kfla_6742Help
Entry
Kfla_6742         CDS       T01155                                 

Definition
XRE family transcriptional regulator
Organism
kfl  Kribbella flavida
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(7215149..7217572)
Genome map
AA seq 807 aa AA seqDB search
MVPVSTPPFAHLLRHLRTTAGLTQERLAERSGLSPQAIGALEGGRRQYPRPTTVAQLADA
LSLSPEDRHRLTTAAHRPKAGDPASAVPRQLPPPITDFTGRTTELDTLVALLRAPHAAAP
GIVISAIGGMAGIGKTTLAVQAAHRVADVFPDGQLYLNLRGGGRDPVRPVDALAALLLGL
GVPPSGDPQDERIAAARFRTAMAGRRMLVVLDDAAGIEQVTPLLPGTPSSAVVITSRRRL
TALPGVRHVDLDLLTEHEALQLLGEVVGPEWVEAAPNDARRIVQRCGHLPLAIRIAGGQV
RGSSDGAGTLGGLAERLTGDADRLGLLDGPQASVRASIAVSIGALIAADQPLDLAAAQAF
PWLSLLDGNHFSLRVASAVLELPLQRTEEVLERLVDIQLLETPALHRYRMHDLVRAVGRE
QAKVSLTPTDLAGAQHRELAQYAAMLWRLEKLRGEKLRSYAIASGAEEVTDLGEAAAWLE
SELANMVRLVRAAAATWPGERHLVASIALGLRRFSSLRMRFAEPRDALQAVVERLTDEDP
DELTMHLLVALGQMNAAMAQYEQAAALHRRALPLVEARGDVLAMTNFLIDLSYFLGRASE
PAAAIEYAERALALAPEAGSPRAVPLAHLVVGTSAGGLGDIDRQRSAFERATQLIATTPG
PARAMYLSQIGWSLAESGQFDTAVEVLTDGLEAAQGNETGVVGIDLYLYLGRVWLALDHH
ADAIEAFTIAGKLAAECPAEGREPMAHHELGRAHAALGNHDQARDEWQRAATLYDRIAAP
AADEVRALLAGLDGGDQGGGASSAVQR
NT seq 2424 nt NT seq  +upstreamnt  +downstreamnt
atggtgccggtgagcaccccgcccttcgcccacctcctccgccacctgcgcaccaccgcc
ggcctcacccaggaacgcctcgccgaacgctcaggcctcagcccgcaagccatcggcgcc
ttggagggcggccgccgccagtacccccgcccgaccaccgtcgcccagctcgccgacgcg
ctgtctttgtcccccgaagaccgtcatcgcctcaccaccgccgcccaccgccccaaagcc
ggcgaccccgcgtccgccgtaccgcgccagctcccacctcccatcaccgacttcaccggc
cgcaccactgagctcgacaccctcgtcgccctgctccgcgcaccccacgccgccgccccc
ggcatcgtcatctccgccatcggcggcatggccggcatcggcaaaaccaccctcgcggtt
caggccgcccaccgggtcgccgacgtgtttccggacggccagctctacctgaacctgcgt
ggcggcggccgtgaccccgtgaggccggtcgatgcgttggcggctttgcttctaggcctc
ggggtaccgccgagcggggaccctcaggacgagcggatcgctgccgcgcgattccgtacg
gcgatggctggtcggcgcatgctggtggtgcttgatgacgcggccgggatcgagcaggtg
acacctctgcttcctggcactccgagctccgcagtcgtgatcaccagccggcggcgcctc
accgctctcccgggggtacggcacgtcgatctcgacttgctgacagagcacgaagccctg
cagttgcttggtgaggtggtcgggccggagtgggttgaagcggcgccgaacgacgcgcga
cggatcgtgcagcgctgcggccatctgccgttggcgatcaggatcgccggtggccaagtc
cgcggttcctccgacggtgccggcacgctgggcggcctggctgagaggctgaccggtgac
gccgatcggcttgggcttctcgacgggccgcaggccagcgtccgggcgagcatcgcggtg
tccatcggtgcgctgatcgccgcagaccagccgctcgatctcgcggccgcgcaagctttt
ccgtggctgtccctgctcgacggcaaccatttctcgttgcgggtggcatccgctgtcctg
gaactcccactgcagcgcaccgaggaggtcctcgagcgactggtcgacattcagctcctg
gagacgccggctctccatcggtaccgcatgcacgaccttgtccgcgccgtcggacgtgaa
caggcgaaggtcagcttgacgcccacggaccttgcgggagctcagcaccgtgagctggct
cagtacgccgcgatgctctggcgcctggagaagcttcgcggcgagaagctgcgcagctat
gccattgcctcaggcgcagaggaagtcacggacctcggtgaagccgctgcttggctggag
tccgagcttgcgaacatggttcggctcgtccgggctgctgcggccacttggccgggcgag
cgtcacctcgtcgcgtcgatagccctcgggctgcgccgcttctcgtcgttgcgaatgaga
ttcgctgagccacgcgacgcactccaggcggtggtcgaacgcctcaccgacgaggaccct
gacgaactcaccatgcaccttctcgtcgcactcgggcagatgaacgcggctatggcgcag
tacgagcaggcggccgctctgcaccgtcgagcgctgccgctggtggaagctcgcggagac
gtcttggcgatgaccaacttcttgatcgacttgtcgtacttcctcggccgcgccagcgag
ccggcggcggccattgagtacgccgaacgcgcgctcgcgctggcaccggaggcaggcagt
ccccgggcggtgccgctcgcccacctggtcgtcggtacgtcggcgggcggactcggtgac
atcgaccgccaacggagtgcgttcgaacgagctacgcaactgatcgcgacaacgcccggg
cccgcgcgcgccatgtatctcagtcagatcggctggtccttggcggagagcggccagttc
gacacggcggtcgaggtgctgaccgacggcctggaagcggcccagggtaacgagaccggc
gtcgtaggaatcgacctgtacctctacctgggccgggtgtggcttgcactcgaccaccat
gccgacgcgatcgaggcgttcacgatcgcggggaagctggcggcggagtgccccgccgag
ggcagagagccgatggcgcaccacgaactcggccgcgcccacgccgcgctgggcaaccat
gatcaggcccgcgacgaatggcagcgagccgcgacgctctacgaccgaatcgcggcaccg
gctgccgatgaggtccgcgcactgctggccggtctcgacggcggcgaccagggcggaggc
gccagttcagctgtccaacggtag

DBGET integrated database retrieval system