KEGG   Kribbella flavida: Kfla_7026Help
Entry
Kfla_7026         CDS       T01155                                 

Definition
alcohol dehydrogenase zinc-binding domain-containing protein
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
kfl  Kribbella flavida
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:kfl00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Kfla_7026
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Kfla_7026
  Lipid metabolism
   00071 Fatty acid degradation
    Kfla_7026
  Amino acid metabolism
   00350 Tyrosine metabolism
    Kfla_7026
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Kfla_7026
   00626 Naphthalene degradation
    Kfla_7026
Enzymes [BR:kfl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Kfla_7026
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(7518476..7519792)
Genome map
AA seq 438 aa AA seqDB search
MIIRGAVLREMGLPQPYAESRPLRTEQVELAPPGPGELLVRVRAAGLCHSDLSVIDGSRP
RVMPMLLGHEATGEVVRSEAPGFAPGDTVGFAFVPACGGCGPCAEGRAALCEPGAAANTA
GTLLGGAQRLDGVHHHLGVSGFADHAVVSARSAVKIDPSLPPEIAALFGCAVMTGVGAVV
NTARIQPGQSAVVFGLGGVGLAALLGAVLAGAHPIVAVDVVPEKLALATSLGATTAIDAR
PTESSAAPTAAPSEVSPNAAIPSGAGPSSGALNAAIPSGAGPSDDARTVTSQSEPASSAA
APRTAAPTAAAFDVVEAVREATAGGADYAFETVGSAAVLGQAYAATRRGGTTVTVGLPHP
YQLLSIPAVSLVAEERTLKGSYLGSAVPSRDIPRYIALYRAGRLPVDRLLTSTVSLDGLN
EAFDELAAGTSIRQVLVF
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgatcatccgcggcgccgtactgcgcgagatgggtttgccccagccgtacgccgagtcc
cggccgctgcggaccgagcaggtggagctggcgccgcctggaccgggcgagctgctggtc
cgggtccgcgcggccgggttgtgccactcggacctgtcggtgatcgacggttcgcggccg
cgggtgatgccgatgctgctgggtcacgaggcgaccggggaggtggtccggtcggaggcg
cccggcttcgcgccgggggacaccgtcggcttcgccttcgtgccggcctgcggtggctgt
ggaccgtgcgcggaagggcgcgcggcgctgtgcgaaccgggcgccgcggcgaacacggcc
ggcaccctgctcggtggcgctcagcgcctggacggagtccatcaccatctcggggtgtcc
gggttcgccgaccacgcggtggtgtcggcacggtccgcggtgaagatcgacccgtcgctg
ccgccggagatcgccgctttgttcggctgtgcggtgatgacgggcgtcggcgcggtcgtg
aacaccgcccggatccagcccggccagagcgccgtcgtcttcggtctcggcggcgtcggg
ctggccgctctgctcggggccgtgctggccggtgcccaccccatcgtcgccgtcgacgtc
gtgcccgagaagctcgcgctcgccacgtccctcggcgccaccaccgccatcgacgcccgc
cccaccgaatcctccgctgccccgaccgccgccccgtccgaggtcagcccgaacgccgcc
atcccgtccggcgccggcccgtccagtggcgccctgaacgccgccatcccgtccggcgcc
ggcccgtccgatgacgcccggacggtcacctcccagtccgagccggcctcgtccgctgcc
gcccccagaactgccgccccgaccgccgctgccttcgacgtggtcgaggcagttcgggag
gctactgctggtggcgccgactacgcgttcgaaacggtcgggagcgcggcggtgctcggg
caggcctacgcggcgactcggcgcgggggcaccacggtgaccgtcggactgccgcatccc
taccaactgctgagcatccccgcggtctcgctggtcgccgaggaacgcacgctcaagggc
tcctacctgggctcggccgttcccagccgcgacatcccgcgctacatcgctctctaccgc
gcgggtcggctcccggtggaccggctgctcacgtcgacggtctcgctcgacggcctcaac
gaagctttcgacgagctggccgcgggcacttccatccggcaggtcctggtcttctga

DBGET integrated database retrieval system