KEGG   Kribbella flavida: Kfla_7049Help
Entry
Kfla_7049         CDS       T01155                                 

Definition
glucan endo-1,6-beta-glucosidase (EC:3.2.1.75)
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
kfl  Kribbella flavida
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kfl00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    Kfla_7049
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Kfla_7049
Enzymes [BR:kfl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     Kfla_7049
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7540956..7542896
Genome map
AA seq 646 aa AA seqDB search
MRRQTLGAAVAATALLAAGPAPGAAVGAETNGPAAGRGPTAQARVWVTTPDRAELLHERT
PVTFGQGSSSRTTITVEPTTKYQTMDGFGASITDSSASVLHQLPAADREKTMRSLFDPRQ
GIGVSFLRQPIGSSDFTAQAEHYTYDDVPPGQTDFTLRRFSIAHDQRQILPLLRRAKQLN
PALKVMGTPWSPPAWMKTGDSLVGGRLKDHPAIYNAYARYLVKFVQAYTAAGVPIDFLSI
QNEPQHRAPSGYPGMDLPVRQAAAVIEQLGPMLRAVSPRTKILGYDHNWSTHPGDVGNTP
PGEDPETDYPYQLLSTPAARWIAGTAYHCYAGTPADQSKLRQAFPDKGIWFTECSGSHGP
NDTPPQIFRGTLTWHARTLMIGTTRNWSKSVVNWNIALNADGGPHNGGCDTCTGLVTRHP
DGSVSTDAEYYTIGHLSKFVKPGATRIGSTSYGTTGWNGQLMSAAFRNPDGSTALVVHNE
NDAPREFAVAVGGRSFEYTLPGGSIGTFVWTRDLRSELTPVSLTTAHATASVGADVAALA
IDADGSTLWQSKTARAAGQSVQVDLGTSRTVRRVALDSGGNLGDYATSWELSYSNDGTTW
RPLKTGTSNGQLTNVDVPPTRARHLRITSTSAGDHWWTLADFRVYS
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
atgagaaggcaaacgctgggtgccgccgtggcggccaccgccctgctcgcggccgggccg
gcgcccggcgcggccgtcggcgccgagacgaacggcccggcagccggccgcggaccgacc
gctcaggcgcgggtctgggtgaccacccccgaccgggccgaactgctgcacgagcggacc
ccggtgacgttcggccagggctccagcagccggaccacgatcacggtcgagccgaccacg
aagtaccagaccatggacggcttcggcgcctcgatcaccgactcgtcggcgagcgtgctc
caccagctgccggccgcggaccgcgagaagacgatgcggtcgctgttcgacccgcggcag
ggcatcggcgtcagcttcctgcgccagccgatcggctcgtccgacttcaccgctcaggcc
gagcactacacgtacgacgacgtcccgcccggccagaccgacttcaccctgcggcgcttc
agcatcgctcacgaccagcggcagatcctgccgctgctgcgccgcgcgaagcagctgaac
ccggcgctcaaggtgatgggcacgccgtggagcccgccggcctggatgaagaccggggac
tcgctggtgggcggccggctgaaggaccacccggcgatctacaacgcctacgcgcgctac
ctggtgaagttcgtgcaggcgtacacggcggccggcgtcccgatcgacttcctctcgatc
cagaacgagccgcagcaccgcgcgcccagcggctatcccggcatggacctgccggtccgg
caggcggccgcggtgatcgagcagctcggcccgatgctgcgcgcggtcagcccgcgcacc
aagatcctcggctacgaccacaactggtccacgcatcccggcgacgtcggcaacaccccg
cccggcgaggacccggagacggactacccgtaccagctgctcagtacgccggccgcccgc
tggatcgcgggcacggcgtaccactgctacgcgggcacgccggcggaccagtcgaagctg
cggcaggccttcccggacaagggcatctggttcaccgagtgctccggctcgcacgggccg
aacgacaccccgccgcagatcttccgcggcacgctgacctggcacgcccgcaccctgatg
atcggcaccacccggaactggtcgaagtcggtggtgaactggaacatcgccctgaacgcc
gacggcggcccgcacaacggcggctgcgacacctgcaccggcctggtcacccggcacccg
gacggctcggtcagcaccgacgcggagtactacacgatcggccacctgtcgaagttcgtg
aagccgggcgccacgcggatcggcagtacgtcgtacggcacgaccgggtggaacgggcag
ctgatgtcggccgccttccgcaatcccgacgggtcgacggcgctggtcgtgcacaacgag
aacgacgcgccgcgggaattcgcggtggcggtcggcggccggtccttcgagtacaccctg
cccggcggctcgatcggcaccttcgtctggacgcgtgacctgcggtcggagttgacgccg
gtgtcgctgaccaccgcccacgcgaccgcgtcggtcggtgcggatgtcgccgcgctggcg
atcgacgcggacggctcgacgctgtggcagtcgaagacggcgcgcgcggccggccagtcc
gtgcaggtcgacctcggtacctcgcgcacggtccgccgggtcgctctcgacagcggcggc
aacctcggcgactacgccacctcgtgggaactgagctacagcaacgacggcaccacctgg
cgcccgctgaagaccggcacctcgaacggccagctcacgaacgtggacgtgccaccgacc
cgtgcgcgccacctccgcatcacgtcgacctccgccggcgaccactggtggaccttggcc
gacttccgcgtctacagctga

DBGET integrated database retrieval system