KEGG   Candidatus Kinetoplastibacterium galatii: ST1E_0252Help
Entry
ST1E_0252         CDS       T02466                                 

Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
kga  Candidatus Kinetoplastibacterium galatii
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:kga00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ST1E_0252
  Amino acid metabolism
   00340 Histidine metabolism
    ST1E_0252
Enzymes [BR:kga01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     ST1E_0252
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(23712..25022)
Genome map
AA seq 436 aa AA seqDB search
MTTIKRLDSLDPNFNSSLSSILEFDSSEDKSIEETVNLILKDIKNDGDKALLNYTKKFDR
LDINSPDKLEIPKEEWVKALNNVPKKQREALEISVSRIREYHEKQRASTWSYEDSDNNIL
GQKITPIDKVGLYVPGGKASYPSSVLMNAIPAKIAGVPELIMVSPTPDGHVNSMVLAAAA
LGNVDRIFAIGGAQAIGALAYGTETVTQVDKIVGPGNAYVAYAKRKVFGTVGIDMIAGPS
EILIICDGNTPAEWIAMDLFSQAEHDELAQSIMLCPDLDFINEVEYQINKLLYKMPRFDI
LKKSLSNRGALIKVRDLYEACDIANMIAPEHLEISTENANELVQFIRHAGAIFIGRFSSE
SLGDYCAGPNHVLPTSRTARFSSPLGVYDFQKRSSLINISEKGSINLGKTASILATGEGL
QAHASSAQYRIDGNIS
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgactacgattaaacgtcttgattctcttgatccaaatttcaactcctctctctcttct
atattggaattcgactctagtgaagataaatcaattgaggaaacagtaaatctaatacta
aaagatataaagaatgatggggacaaagctttattaaattatactaaaaaatttgataga
cttgatataaactctccagataaattggaaatcccaaaagaagaatgggtaaaagcacta
aacaacgttcctaagaagcaacgtgaagcattagaaatttctgtcagtaggatcagggaa
tatcatgaaaaacaaagagcatctacttggagttacgaagactcggataataatatactt
ggccagaaaataacccctatcgacaaagttggtttatacgtaccaggtggtaaagcttca
tacccatcatctgttcttatgaatgcaatacctgctaaaatagctggcgttcctgagttg
attatggtatctcctactccagatggtcatgttaatagtatggttctagctgctgctgca
ttaggcaatgtagacagaatatttgccataggtggtgcacaagctataggtgctttggct
tatggcacagaaacagttactcaagtagataaaatagttgggccaggaaacgcttacgta
gcatatgcaaaacgtaaagtttttggaactgtaggcatagatatgatagctggccctagt
gaaatattgattatatgtgatggaaatacaccagcagaatggatagctatggatttattt
tcacaagcagaacatgatgaactagcacaatcaataatgctatgcccagatttagatttt
ataaacgaagtagaataccaaattaataaactactttataaaatgcctagatttgatatt
ttaaagaaaagtctatctaatcgaggtgctctgattaaagttagagatctatatgaagct
tgtgatatagcaaatatgattgctccagaacatctagaaatatctacagaaaatgctaat
gaactagtacaattcatcagacatgcaggagcaatatttataggacgttttagttcagaa
tcattgggtgattattgtgctggacctaatcatgttttaccaacatctcgtacagcaaga
ttttcttcaccactaggtgtgtatgattttcaaaaacgttctagccttattaatatttca
gaaaagggatctataaatttagggaaaacggcatcaattttggcaactggtgaaggacta
caagctcatgcatcaagtgcccaatatcgcatagatggaaatatatcatga

DBGET integrated database retrieval system