KEGG   Candidatus Kinetoplastibacterium galatii: ST1E_0494Help
Entry
ST1E_0494         CDS       T02466                                 

Definition
uroporphyrinogen-III synthase hemD (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
kga  Candidatus Kinetoplastibacterium galatii
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:kga00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    ST1E_0494
Enzymes [BR:kga01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     ST1E_0494
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
240426..241223
Genome map
AA seq 265 aa AA seqDB search
MLAKKVFILTRPNSNKILSDRLSDIGFESLSLPSLKIVSLDLQNVPLPEIYDFIFFSSSN
AVKFYLIQLNKIYGPIKTWPTKTVIVTVGSATADSFRSCNFINMDLLTILSPDSSAAQLD
SESLWKVLRNQSLYGKRFLFVRGTTGRDWLINKVSKYCEVDICSVYSRDNIEWSYNDSEQ
LKSISVGSTSTVIWLFTSTESVEATIRNITILNLSNWFNSCKFIVTHRRIYNFLSDYFLK
RRVSEIFIKECLPYNESIISACKDI
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgcttgccaaaaaagtttttattctaacaagaccaaatagcaacaaaatattgtctgat
agacttagtgatattggttttgaatctctatcccttccttctttgaaaattgtatcttta
gatttgcagaatgttcctttaccagaaatttatgattttatctttttctcaagtagtaat
gctgttaaattttatttaatccaattaaataaaatttatggtcctataaaaacatggcct
accaagacggtaatcgttacagtaggctctgcaactgctgatagtttccgttcttgtaat
tttattaacatggatttattgacaatacttagtcctgattcttctgctgcacaactagat
tctgaatctttatggaaagttctaagaaatcagtctttgtatggcaaaagatttcttttt
gttaggggaactactggtagggattggcttattaataaagtttctaagtattgtgaagtt
gatatatgctctgtatattcaagagataatatagaatggtcctacaatgattcagagcaa
ctaaaatcaatatcggttggatcaacttctacagttatatggttatttactagcacagag
agcgtggaagctactattagaaatataactattctaaatcttagtaattggtttaacagt
tgtaaatttatagttactcatcgtaggatctacaattttttatcagattattttctaaaa
cgtagagtttcagagatttttataaaagagtgtttgccttataacgaatctattatttca
gcatgtaaggatatttag

DBGET integrated database retrieval system