KEGG   Kluyvera intermedia: AB182_14640Help
Entry
AB182_14640       CDS       T03950                                 

Definition
(GenBank) glycosyl hydrolase
  KO
K01193  
beta-fructofuranosidase [EC:3.2.1.26]
Organism
kin  Kluyvera intermedia
Pathway
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kin00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    AB182_14640
   00500 Starch and sucrose metabolism
    AB182_14640
Enzymes [BR:kin01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     AB182_14640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2378996..2380489
Genome map
AA seq 497 aa AA seqDB search
MRTFITATFVALLALSVGNTPGYSQMSKETLQNKSISQVNDFFPRIEGSFIGDPMPVYND
GVFNIFYLNDVRGGSDLGVHAIHLLSSANLYNYQNHSEVIPYVNDVNDPELLLGTGSIIK
VGDTWHAWYTAHNENVFPVESIMHATSKDRFHWVKHPQDTILPGANYRGNDFRDPHVVWV
DEKKEYWMLITTRSKGRGIIARYSSTDLKNWEDRGVFFDNDTITSNSNLECPTLVFFNGR
WYLSFSDQWPLRLTQYRVADNPEGPWHKMDNYVVDGSGLYAGKLTIKDGRLFVFGWIPTK
AGNSDSGNIDWAGNLVVHELTAGIKGQLNSIIPQELQKAIKDNRGPVQMIQPVKTLKTST
QFGLLQSTIYPALPRRGELSATVDIPSSGMVMSFGLKDDRVSDAMLNVVFNRSKGKVYFF
NSPLASINQSNAESWVDVPLGEKINLRVLIQNSIAVFYINDKAAFSTRMYSMPENHWSIS
LPQHDSLHATLQFKEMI
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgagaacatttattacggcgacgttcgtcgctctgctggcgctttctgttggaaatacc
cccgggtattcacagatgtccaaagaaacattacagaacaaaagcatcagccaggttaat
gactttttcccgcgcattgaagggtcatttattggcgatccaatgcctgtctataacgat
ggtgtgtttaatattttttatctcaatgatgtgcgcggcggcagcgatttaggcgtacat
gcgattcacctgctctccagcgccaacttatataattatcagaaccattctgaggttatt
ccttacgttaatgatgtcaatgatccagagctgcttttagggactggctccattatcaaa
gtgggcgatacctggcacgcatggtataccgcacacaatgaaaacgtatttccggttgag
tcaatcatgcatgccaccagtaaagatcgttttcactgggtcaaacatccacaggacacc
atcctgccgggcgctaactatcgaggcaatgacttccgcgatccgcatgttgtctgggtt
gatgaaaagaaagaatactggatgctgatcacgacccgcagcaaggggcgcgggattatc
gcgcgctacagctcaacggatttaaaaaattgggaagaccgtggagtattttttgacaac
gacaccatcaccagtaattcaaaccttgaatgcccgacactggtcttctttaatgggcgc
tggtatctgagctttagcgatcagtggccactacggttgacgcagtaccgcgttgcggac
aatccagaagggccatggcataagatggataattatgttgtggatggctcaggtttgtat
gccggtaaattgaccatcaaggatggacggttatttgtgtttggatggatcccgacaaag
gcaggaaacagcgacagtggcaatatcgactgggcaggaaacctcgtcgtccatgaattg
accgcaggtataaaaggtcagctcaacagcataattccacaagaacttcagaaggcgatc
aaagataaccgtggtccggttcagatgatacagccggttaaaacgctcaaaacctcaaca
caatttggtctcttacagtcaactatttatccggctttacccaggcgtggagaactgtcc
gcaacagtggatattccctcctcgggaatggtcatgagcttcgggctgaaagatgaccgc
gtgagtgacgcgatgcttaacgttgtattcaacaggagcaaaggcaaagtttatttcttt
aattctccattggcgtccatcaatcagagtaatgctgaatcctgggttgatgttccgctc
ggtgagaaaattaatcttcgtgtgctaatacagaactcaatagccgttttttatattaac
gacaaagcggcatttagcacccgtatgtattccatgccggaaaatcactggagtatcagt
ctgcctcaacacgatagtctccatgcaacgttgcaatttaaagaaatgatctaa

DBGET integrated database retrieval system