KEGG   Kangiella koreensis: Kkor_0158Help
Entry
Kkor_0158         CDS       T00973                                 

Definition
cytochrome c class I
Orthology
K08738  
cytochrome c
Organism
kko  Kangiella koreensis
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:kko00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Kkor_0158
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Kkor_0158
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
162144..162584
Genome map
AA seq 146 aa AA seqDB search
MKIILLLTLFSVLTGCTLSANQTVEESKQKQNQEVVAENSVSKELITQGAKYFRFRCGGC
HEMSTEKGSSFGPHLEGIIGRKVGAVEGYDYSNALKEADFVWTEEVMANWLAKPESLLPG
MCMTFKGVPDEDVRRAMIAFMKEPGL
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atgaaaataatactgttattaacgttattctcagttttgactggctgcaccttatcagct
aaccaaacagtggaagaatcgaaacaaaaacagaatcaagaagtggttgctgaaaattct
gtatccaaagaactgatcactcagggcgcaaaatattttcgctttcgttgtggcggttgc
cacgaaatgagtactgaaaaaggttcaagctttggaccgcaccttgagggtattattggg
cgaaaagttggggctgtagaaggttatgattattcaaacgcattaaaagaagctgacttt
gtgtggactgaagaagtgatggctaactggttggcaaagcctgaatcattactgccgggt
atgtgcatgacctttaaaggtgtgccagacgaagacgtgcgcagggcaatgatagctttt
atgaaagagccaggcttataa

DBGET integrated database retrieval system