KEGG   Kangiella koreensis: Kkor_0158Help
Entry
Kkor_0158         CDS       T00973                                 

Definition
(GenBank) cytochrome c class I
  KO
K08738  cytochrome c
Organism
kko  Kangiella koreensis
Pathway
kko01100  Metabolic pathways
kko01120  Microbial metabolism in diverse environments
kko02020  Two-component system
Brite
KEGG Orthology (KO) [BR:kko00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Kkor_0158
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C CCDC23 Cytochrom_C550 Cytochrome_CBB3
Motif
Other DBs
NCBI-ProteinID: ACV25579
UniProt: C7R6R3
Position
162144..162584
Genome map
AA seq 146 aa AA seqDB search
MKIILLLTLFSVLTGCTLSANQTVEESKQKQNQEVVAENSVSKELITQGAKYFRFRCGGC
HEMSTEKGSSFGPHLEGIIGRKVGAVEGYDYSNALKEADFVWTEEVMANWLAKPESLLPG
MCMTFKGVPDEDVRRAMIAFMKEPGL
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atgaaaataatactgttattaacgttattctcagttttgactggctgcaccttatcagct
aaccaaacagtggaagaatcgaaacaaaaacagaatcaagaagtggttgctgaaaattct
gtatccaaagaactgatcactcagggcgcaaaatattttcgctttcgttgtggcggttgc
cacgaaatgagtactgaaaaaggttcaagctttggaccgcaccttgagggtattattggg
cgaaaagttggggctgtagaaggttatgattattcaaacgcattaaaagaagctgacttt
gtgtggactgaagaagtgatggctaactggttggcaaagcctgaatcattactgccgggt
atgtgcatgacctttaaaggtgtgccagacgaagacgtgcgcagggcaatgatagctttt
atgaaagagccaggcttataa

DBGET integrated database retrieval system