KEGG   Kangiella koreensis: Kkor_0601Help
Entry
Kkor_0601         CDS       T00973                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
kko  Kangiella koreensis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Brite
KEGG Orthology (KO) [BR:kko00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Kkor_0601
   01230 Biosynthesis of amino acids
    Kkor_0601
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Kkor_0601
   00030 Pentose phosphate pathway
    Kkor_0601
   00051 Fructose and mannose metabolism
    Kkor_0601
   00052 Galactose metabolism
    Kkor_0601
  Energy metabolism
   00680 Methane metabolism
    Kkor_0601
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Kkor_0601
Enzymes [BR:kko01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Kkor_0601
Protein phosphatases and associated proteins [BR:kko01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Kkor_0601
Messenger RNA biogenesis [BR:kko03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Kkor_0601
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(606615..607880)
Genome map
AA seq 421 aa AA seqDB search
MAKKKYNAFYAQSGGVTAVINATACGVIETARASKNIGKVYAGKNGIIGALREELIDTSK
ESKKDIAGLKFTPSGAFGSCRHKLKSIEENKAEYERLIEVFKAHDIRYFFYNGGGDSQDT
AHKVSQLSETMGYPITCIGIPKTVDNDLPITDNCPGFGSVAKYVAVSIREAAFDVKSMAE
TSTKVFVMEVMGRHAGWIAAAGGLACEKEGDAPHIILFPEIAFNKEKFLKKVDRTVKKFG
YCAIVVSEGTAYKDGTFLADAGTVDAFGHKQLGGVAPEVANMIKDELGYKYHWAVSDYLQ
RAARHIASATDVDQAYAMGKAAVEFADAGKNAVMPTIVRKNTKKYSWTVGEAKLADVANV
EKMMPRSYITRDGFGITEECRQYLQPLIQGESYPPYKNGLPQYVELKNELVKKKLKTKFK
I
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atggctaagaaaaaatacaacgctttttatgcccaatccggtggcgtaacggcagtaatc
aatgcaactgcgtgtggtgtgattgaaacagcgcgcgcgtcaaagaacattggcaaggtg
tatgctggtaagaacggtattatcggcgctttacgcgaagagttgattgataccagcaaa
gaatcaaaaaaagatattgctggtcttaagttcacgccgtctggtgctttcggttcctgt
cgccataagttaaaaagtattgaagaaaacaaagctgagtacgagcgtctgatcgaagtg
ttcaaggcgcatgatattcgttatttcttctacaatggtggcggtgattcgcaggatacc
gcacacaaagtttctcaattaagtgaaaccatgggttatccgataacctgtatcggtatt
cctaaaactgttgataacgatttacccattaccgataactgcccaggctttggctcagta
gccaagtatgtcgcagtttcgattcgcgaagcagctttcgatgttaaatcgatggcagaa
acatcaaccaaagtcttcgtcatggaagtgatgggccgtcacgcaggctggattgcagcg
gctggtggtttagcttgcgaaaaagaaggcgacgcgccacatatcatcctgtttccggaa
attgctttcaataaagaaaaattcctcaagaaagtggatcgcactgttaagaagttcggc
tattgtgcgattgttgtttcagaaggtacagcttataaagacggaactttcctggccgat
gcaggcacagttgacgcctttggtcataagcaactcggtggtgtcgcacctgaagtcgcc
aatatgattaaagatgaacttggctataaatatcactgggccgtttctgattatttgcaa
cgcgctgcgcgtcatatcgcctcagcaacggacgttgaccaggcctatgctatgggtaaa
gccgccgttgaatttgccgatgccggtaagaatgctgtgatgcctaccatagttcgcaag
aacaccaaaaaatacagctggacagttggtgaagctaaactagccgatgttgccaatgtg
gaaaagatgatgccacgcagctatatcacacgcgatggttttggtatcaccgaagagtgc
cgccaatacctgcagccattgattcaaggtgaatcatacccgccatacaaaaatggtctg
ccgcagtatgttgaacttaaaaacgaattggtgaagaagaagcttaaaaccaagtttaag
atttag

DBGET integrated database retrieval system