KEGG   Kangiella koreensis: Kkor_0627Help
Entry
Kkor_0627         CDS       T00973                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
kko  Kangiella koreensis
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:kko00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(638115..639002)
Genome map
AA seq 295 aa AA seqDB search
MSFTRATGSLNDQGYSYWPSPAKLNLELRVLGQRADGYHELQTLFQLLDFGDDLWIKPND
TGELTLVSEYNEVPSEQNLVIKAARILQPFCKNSAKSPHGADIKLTKRLPSGAGLGGGSS
NAATTLVALNQLWNLHLDQQQLIDLGRQLGADVPVFVNGHSAWAEGIGELLTNTDIPEKW
YLIVYPNVHVNTGKIFSHSALTRNDKPIKLRATREGSLPEVGYNAMQTLVLELYPEIKEA
FEHLSQYGKVMLTGTGSCLFLTFDNEREVRKIAALCKQRWLTLEARGINASPLIK
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgagcttcacccgtgcaaccggtagcctcaatgatcagggctacagctattggccctcg
ccggccaaactcaacttagagttgcgagtgttaggtcaacgcgccgacggttaccacgaa
ctgcaaaccctgtttcaattattagatttcggcgacgatctctggattaaacctaacgat
accggcgaactgactctggtcagcgaatacaacgaagtccccagcgaacagaacctggtc
ataaaagctgcccgaatcttgcagcctttttgcaaaaactcagccaaaagcccccacggc
gcagatattaaactgaccaagcgattgccctccggtgcaggccttggcggcggcagttcc
aatgccgctaccaccttagttgctcttaatcagttatggaatctgcatctcgatcagcag
caattaatcgatctaggtcgtcaattgggtgcagatgtgccagttttcgtcaatggtcat
agcgcctgggcggaagggattggcgaacttttaaccaacaccgacatacccgaaaagtgg
tatctcattgtctatccaaacgttcatgtgaacaccggcaaaattttttcacattcagcg
ttgacaagaaacgacaaacccattaaattacgcgccactcgcgaagggagtttgcctgaa
gttggttacaacgccatgcaaacactggttctcgaactttatccggagataaaagaagcc
tttgagcatctgtctcaatacggaaaagtgatgctaaccggaaccggaagttgtctcttc
ttaacctttgacaacgagcgagaagtccgtaaaatagccgctctgtgcaagcagcgctgg
ctaactttagaagctagaggtatcaacgcctccccgctgataaagtaa

DBGET integrated database retrieval system