KEGG   Kangiella koreensis: Kkor_0679Help
Entry
Kkor_0679         CDS       T00973                                 

Definition
(RefSeq) glutaminase
  KO
K01425  
glutaminase [EC:3.5.1.2]
Organism
kko  Kangiella koreensis
Pathway
Arginine biosynthesis
Alanine, aspartate and glutamate metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kko00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Kkor_0679
   00220 Arginine biosynthesis
    Kkor_0679
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    Kkor_0679
Enzymes [BR:kko01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     Kkor_0679
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(689631..690581)
Genome map
AA seq 316 aa AA seqDB search
MKYNEIFEKIAAELKDYDQIGQVATYIPALAKANPNKFGMYLVTREGHSYFHGDTDETFS
IQSISKVLSLVYAFKLVGTDLWKRVGVEPSGSPFNSLVQLEYEQGIPRNPLINAGAIVIC
DILMSELKNPYQDFIKFLRSLAGNPNIDYCKTTAESEKECGFKNSAHINLMKSYGNIEND
AEEVLDFYFHLCSIEMSCKDLAQTFMFLASGGKNPVNNKRIITAQETKRINSIMLLCGFY
DEAGEFAFRVGLPGKSGVGGGIVAIYPDQYSIAVWSPGLNTKGNSSKGIKALELFTTITQ
SNVFGPSPIFDELEYE
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgaaatacaacgaaatattcgaaaaaatcgctgcagagctcaaggactatgaccaaatt
ggacaggtagcgacctatattcctgctctggccaaggctaatcccaataaatttggtatg
tacctggtaaccagagaaggacacagctacttccatggcgataccgacgagacattttct
attcagagtatatccaaggttctgtcactggtttatgcattcaaactagtgggcactgac
ttgtggaagcgcgttggggtagaaccttcgggcagtccttttaattctttagtacagctt
gaatacgaacaagggatacctcgcaacccattaatcaatgctggtgcgatagtcatttgc
gatattctgatgagcgaattgaaaaacccatatcaggacttcatcaagtttctgcgctcg
ctagcaggcaaccccaatattgattactgcaaaaccactgcagaatcagaaaaagaatgt
ggttttaaaaacagtgcccatatcaacctaatgaaatcgtatggcaatatcgaaaacgac
gctgaagaagtattagacttctatttccatctttgctcaatagaaatgtcatgcaaagat
ttggctcagacctttatgttcctcgcaagtggaggcaagaacccagtcaacaacaaacga
ataataaccgctcaggaaaccaaacgtatcaactccatcatgttgctttgtggcttctat
gatgaggcaggagagtttgcctttagagttgggttacccggtaaaagtggtgtcggcggt
ggaatcgtagccatctacccagaccaatacagcatcgcagtatggagcccaggactaaac
actaagggcaattcaagtaaagggatcaaagcacttgaactatttacgaccattactcaa
tcaaacgtttttggaccctcgcctatttttgatgagctggaatatgaatag

DBGET integrated database retrieval system