KEGG   Kangiella koreensis: Kkor_0713Help
Entry
Kkor_0713         CDS       T00973                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
kko  Kangiella koreensis
Pathway
kko00010  Glycolysis / Gluconeogenesis
kko00020  Citrate cycle (TCA cycle)
kko00620  Pyruvate metabolism
kko01100  Metabolic pathways
kko01110  Biosynthesis of secondary metabolites
kko01120  Microbial metabolism in diverse environments
kko01130  Biosynthesis of antibiotics
kko01200  Carbon metabolism
Module
kko_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:kko00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Kkor_0713
   00020 Citrate cycle (TCA cycle)
    Kkor_0713
   00620 Pyruvate metabolism
    Kkor_0713
Enzymes [BR:kko01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Kkor_0713
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 HlyD_D23 HlyD_3 PASTA GCV_H PYNP_C Peptidase_M23 DUF2118 CDC45 DUF1510
Motif
Other DBs
NCBI-ProteinID: ACV26133
UniProt: C7RA14
Position
728806..730485
Genome map
AA seq 559 aa AA seqDB search
MADITQVKVPDIGDASGVDVIEVLVKVGDTIELEDGLIVLETDKATMEVPSSHAGVVKSI
EIKVGDKVSEGDVILSIEAAETSAEADDSAGEESEERQADETEESQDDSKQQTSPQETEE
DDSSDDEEQAGEEKEEPLIIPDIGDASGVDVIEVSVQAGDSIEKDDSLIVLETEKATMEV
PSPSAGTIVSMSVKAGDKVSQGDQIGVIKTVSSKPSKAKTAEQKSEQSSEPAQDSPKQPD
TPKPAPVSDYPVQSPQEGKLVHASPAVRRLAREFGVDLSKVKGTGPKSRVMKEDVQSFIK
FELSRPKATASSGAVGTPDLPEIDFSKFGEVEQKPLSRIQKISSVNLHRNWTMIPHVTQH
EDADITELDAFRKSMKDEAAKEGVRLTPLAFIMKALVASLKAFPSFNASLANDGENLILK
KYYNIGVAVDTPDGLVVPVIRDVDKKSVYELANELGEMSEKARNKKLGAADMQGGCFTIS
SLGGIGGTSFTPIVNWPDVAILGLSRNQMKPVWNGKEFEPRMMLPMSLSYDHRVIDGAVA
ARFIVHLSKMLGDIRRVIL
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
gtggcagatattacacaagtaaaagtccccgatattggtgatgccagtggggttgatgtt
attgaagtattggtcaaggtcggtgacaccatcgagcttgaggatggtttgattgttctg
gaaactgataaggctactatggaagtgccttcgagccatgctggcgtggtcaaatccatt
gaaataaaggtcggtgataaggtttccgaaggtgatgtcatcttgtccattgaagctgct
gaaactagcgcagaggctgatgattctgcaggtgaagaatcagaggaaagacaggctgat
gaaactgaggagtctcaagacgactcaaaacagcagacttctccacaggagactgaagag
gatgattcctccgatgacgaagaacaagcaggcgaagaaaaagaagagcctttaatcatt
cccgacattggtgatgccagtggcgtagatgtgattgaggttagtgttcaggcgggcgac
agcatcgaaaaagacgatagcttgattgtgcttgaaacagaaaaggcaaccatggaagtg
ccatcgccgtctgcaggtaccattgtctccatgagcgttaaagctggtgataaggtgagt
cagggcgatcaaattggtgtcattaaaacggtttccagcaaaccatctaaagcgaagaca
gcggaacagaagtcggaacaaagttctgaacccgcacaagattcaccaaaacaacctgat
acaccaaaaccagctccggtttctgactaccctgtacagtctccgcaagaaggtaagtta
gtacatgctagcccggcagtgcgtcgtttagcacgtgagttcggagttgacctgagcaag
gtaaaaggcactggtcctaagtcgcgggtcatgaaagaggatgtgcaatcctttattaag
ttcgaattgtcgcgtccaaaagcaactgcaagttcaggagctgtgggcactccagatctt
cctgaaatcgatttctcgaaatttggtgaggtggagcaaaagcctctaagccgaatccag
aaaatcagcagtgtgaatttgcaccgtaactggaccatgatcccccatgtgacccagcac
gaagatgccgacattaccgagctggatgctttccgcaaaagcatgaaagatgaagcagcg
aaggaaggcgttcgtctgactccgcttgctttcatcatgaaagctttggtagcgagtttg
aaagcatttccgagctttaatgcatcactcgccaatgacggtgaaaacctgatcttgaag
aagtattacaatattggcgttgccgtcgatacaccggacggcttggtagtccctgtgatt
cgcgatgtagacaaaaaatcagtctatgaactggccaatgagctgggtgaaatgtctgag
aaagcccgtaacaagaaactgggcgcagccgatatgcaaggtggctgtttcaccatttcg
tcattgggtggcatcggtggtacatcctttacgccaatcgtgaactggccagatgttgcc
attcttggcttatcgcgtaatcagatgaaaccggtatggaatggcaaagagtttgagcca
cgcatgatgttgccaatgtcgctgtcctatgaccaccgggtgattgacggtgcggtggcg
gcgcgctttattgttcatctcagtaaaatgttaggcgatataagacgagtcatactataa

DBGET integrated database retrieval system