KEGG   Kangiella koreensis: Kkor_0762Help
Entry
Kkor_0762         CDS       T00973                                 

Definition
peroxiredoxin
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
kko  Kangiella koreensis
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:kko00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:kko00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(786993..787478)
Genome map
AA seq 161 aa AA seqDB search
MSTIYEYSAILNNGQEVSLEQYKGKVLLIVNTASACGFTPQYEGLQKLYEEYKGQGFEVL
AFPCNQFNNQEKGSDEEIKDFCDLNFHINFPLFKKIDVNGDDAHPLYQYLKSKAPGLLGS
KAIKWNFTKFLISKDGQVITRFATATKPEALAEPIKDALNA
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgtctaccatatacgaatactcagccattttgaataatggccaagaagtttcactggag
caatacaaaggaaaagtgttactgattgtaaataccgccagcgcctgcggctttacgcca
caatatgagggtttgcaaaagctctatgaagaatacaaagggcagggctttgaagtacta
gcctttccgtgcaatcagtttaacaaccaggaaaaaggcagcgacgaagagattaaagac
ttttgcgatctgaattttcatatcaacttcccattgtttaaaaaaattgacgtcaatggt
gatgacgcacacccgctgtatcaatacttaaaaagcaaagcaccaggactacttggtagc
aaggctatcaaatggaatttcactaaatttttgattagcaaagacggccaagtaattact
cgatttgccactgcaaccaagccggaagcattagcagaacctatcaaggatgcacttaat
gcctag

DBGET integrated database retrieval system