KEGG   Kangiella koreensis: Kkor_0833Help
Entry
Kkor_0833         CDS       T00973                                 

Definition
disulfide bond isomerase
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
kko  Kangiella koreensis
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
875948..876706
Genome map
AA seq 252 aa AA seqDB search
MKNLLIILMLSLTIPLASAATKALSEEEVKVMLEARFPGASIDHVSPSEVDSLYSFMLQG
DLYYVSNDGKYLIDGKMLDISTEQIRNISQERISQLDQMKSPMRKREMAKLKDEDMVIFK
APNEEHVISVFTDIDCGYCQKMHRERDDYLSRGITIRYLAFPRAGLKSKSADKLQGIWCA
KDQQTAMTEAKLERKYREGSCTTPFAEHMSLVRKFGIRGTPGIILENGDLVGGYLPAEIM
RQRLDQLKKDTK
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatctgttaattatattgatgcttagcttaactattcctttagcctctgcagct
accaaggctctgagtgaagaggaagttaaagtgatgttagaagcgcgtttcccgggtgca
tcgatagaccatgtttctccctcagaggtggactctctgtattccttcatgttgcaaggt
gatctttattatgtatcaaatgatgggaagtacctgatcgatggcaaaatgcttgatatt
tcaacagagcaaattcgaaatatctcacaggaacgaatttctcagctcgatcaaatgaag
tcaccgatgcgtaaacgtgaaatggctaagctgaaagatgaagatatggttattttcaaa
gcaccaaatgaagagcatgtcattagtgttttcaccgatatagattgtggctattgccaa
aaaatgcatcgtgagcgtgatgattatttaagccggggcattaccattcgctatttagca
ttcccgcgcgctggattaaaatcaaaatcagcggacaaactacaagggatatggtgcgct
aaagatcagcagacagccatgactgaagccaagctagagcgaaagtaccgtgaaggtagt
tgtacgacaccatttgctgagcatatgagcttagtcagaaagtttggtattcgaggaacg
cctggcattatcctcgaaaatggcgacttagtgggtggttacctgccagctgaaatcatg
cgccagcgtttggatcagcttaagaaagacaccaagtaa

DBGET integrated database retrieval system