KEGG   Kangiella koreensis: Kkor_0860Help
Entry
Kkor_0860         CDS       T00973                                 

Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
kko  Kangiella koreensis
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:kko01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:kko00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
906392..907609
Genome map
AA seq 405 aa AA seqDB search
MADKSYIECASNWKRPNLTQSPELFQQVAKLLKEIETGGDLAIDNLSKRFDGFQPRKIEL
RPYRDYELEPQLLNSIEQAAQRIEAFCQLQKGSLQPQQIEEASGVFGFQYSPIEAIGAYI
PGGRFPLISTALMTLIPARVAGCQRRVACSPSVHPAILAAASLAGATEFWQIGGAQAVAA
MAYGYQTMLPVQMVVGPGNQYVNVAKQLLQSRIKIDVAAGPSELLILADSNANQEWLIAD
MAAQAEHDPQAQSVLVSDDIAFLQSIGQQLTANDELNNLLKGEQIVLLQANDCEAMIRFS
NRYAPEHLLLADERIASQSLKHYGSLFIGQNSAVAFGDYCAGPNHTLPTMGSANRSSGLC
VQSFMNIQSYQQINDQGRIQLAEIGRPLAEAEQLVWHERSMQVRS
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atggcggataaatcttacatagagtgcgcttctaactggaagcgtcctaatctcacacaa
tcgcctgaattatttcaacaggtagctaagctattaaaggaaattgagactggtggtgat
ctagccattgataacctcagcaagcgattcgatggctttcaaccgcgtaaaatcgagttg
cggccttatcgtgactatgagctagagccgcaattattaaactcgattgaacaggctgct
caacgtattgaagctttttgtcagttacagaaaggttctttgcaaccgcagcagattgaa
gaagcaagcggcgtgtttggctttcagtatagcccgatagaagcgattggcgcctatatt
ccaggtggacgctttccactgatttcaaccgcactaatgaccttgattccagcgcgcgtt
gcaggttgtcagcgtcgagtcgcttgttccccatcggtacacccagcaattttagcggca
gcttcgttggcgggagcgacagagttctggcaaattggtggtgctcaggccgtcgcagca
atggcctatggttatcagaccatgttgccggtacagatggtggtggggccgggcaatcaa
tatgtgaacgtggcaaagcaattattgcaaagccgtatcaaaattgatgtggctgcggga
ccaagcgagctgctcattcttgctgattctaatgctaaccaggaatggctcattgcagac
atggcagcgcaggctgagcatgatccgcaagcgcaaagtgtattggttagtgacgatata
gcttttctgcaatccattgggcagcagcttactgctaatgatgagctcaataatttactc
aaaggcgagcagatagttttgttgcaagcgaatgattgtgaggccatgatccggttcagc
aatcgctatgcgccagaacacctgttgctggctgatgagcgaatagcgtcgcaaagcctg
aagcattatggctcgctctttattggacagaatagcgcagtagctttcggggattattgt
gccggtccaaaccacacattacctactatgggtagcgcgaatcgttccagcggcttatgc
gtgcaaagctttatgaatatccagtcctatcagcagattaacgatcaaggtcgtatccaa
ttggcggagattggccgaccgctggctgaagctgagcaattggtttggcatgaacgcagt
atgcaggtaagatcctaa

DBGET integrated database retrieval system