KEGG   Kangiella koreensis: Kkor_0864Help
Entry
Kkor_0864         CDS       T00973                                 

Definition
(GenBank) protein-L-isoaspartate O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
kko  Kangiella koreensis
Brite
Enzymes [BR:kko01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Kkor_0864
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT RrnaAD Methyltransf_25 NodS Methyltransf_31 Methyltransf_11 Methyltransf_23 MTS Methyltransf_4
Motif
Other DBs
NCBI-ProteinID: ACV26284
UniProt: C7RAJ2
Position
910087..910755
Genome map
AA seq 222 aa AA seqDB search
MNATHFSGIGMTSARTRGRLVQRLIAEGITNQQVLKAVEDTPRHVFIDEGLSHRAYEDTA
LPIGMGQTISQPYIVARMTQALLESGSMNKVLEIGTGCGYQTAILSKLCKTVFTVERIRA
LHMQARKTLGQLNIHNVQYLFADGFNGWQQNAPFDAIIVTAAPPSIPEKLMAQLANGGRM
VIPVGQTETAQELILVERQGDEFKKTVIEKVKFVPLVSGVAR
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcaactcatttttctggtattggcatgacttcagcgagaacgcgtggccgtttg
gttcagcgcttgattgccgaaggtattaccaatcagcaggttttgaaagcagtagaagac
acgccccgtcatgtgtttattgatgagggtttatcccaccgcgcctatgaagacactgct
ttgcctattggcatggggcagaccatctcgcaaccttatattgtcgcccgtatgactcag
gctttgcttgaatcaggctcgatgaataaggtactagagattggaacaggttgcggttat
caaacagccattttgtccaagctctgcaaaacggtatttactgtcgagcgtattcgagct
ttgcacatgcaagctcgtaagacgttagggcagctgaatattcataatgttcaatatctc
ttcgcggatggctttaatggctggcaacagaacgcgccatttgatgcgattatcgtcacc
gctgctccgccttcaattcctgaaaaactgatggcgcaactagctaatggcgggcgtatg
gttatccccgttgggcaaaccgaaacagctcaagagttgattctggtggagcgccagggt
gatgagttcaaaaaaaccgttattgagaaagtaaaattcgtacctttagttagtggcgtt
gcgcgatga

DBGET integrated database retrieval system