KEGG   Kangiella koreensis: Kkor_0914Help
Entry
Kkor_0914         CDS       T00973                                 

Definition
3'(2'),5'-bisphosphate nucleotidase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
kko  Kangiella koreensis
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:kko00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Kkor_0914
Enzymes [BR:kko01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     Kkor_0914
Transfer RNA biogenesis [BR:kko03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    Kkor_0914
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
960635..961438
Genome map
AA seq 267 aa AA seqDB search
MNKKIIEQKFINKINKVAIDAGAKIMAIYEKDFNIYEKKDDSPLTEADLASHHHIVNELT
ALDVGFPILSEESADIDWSERHSWQTYWLIDPLDGTKEFIKKNGEFTVNIALIHKNEPVL
GVVYAPAIDTLYYASEDIGAWKQESGVAQQINISAKAENPIRVVGSRSHQSDAIAGYLKN
YPNHEMIPMGSSLKLCLVAEGKADLYPRLGPTCEWDTAAAHAIVKAAGGRCVIFDEKTNS
ETEDLSYNTKESLLNPYFIVKGPVINE
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgaataagaaaattatagaacaaaaatttatcaataaaatcaataaagtggccattgat
gcaggtgctaagataatggctatctatgaaaaggattttaatatttacgaaaaaaaggac
gattctcctctcacagaagctgatttagcttcgcatcatcacattgtaaacgaactcacc
gcattagatgtcggatttcctatattatcggaggagtctgcagatatcgattggagtgaa
cgtcactcatggcaaacttattggttgatagacccccttgatggcactaaggaattcatc
aagaaaaatggtgagtttacagttaatatagccttgatccataagaacgagccagttctt
ggtgttgtgtatgcaccggccattgatactctttactatgcttctgaagatataggtgcc
tggaaacaggaatcaggagtggcgcagcagattaatatatccgctaaagctgaaaatccg
atacgagtcgtgggcagtcgctcacatcaatctgatgctatagctggttatttaaagaac
tatccaaatcatgaaatgattccaatgggtagttcgctaaaactgtgcttagttgcggaa
ggtaaagcagatttgtatcctcgcttaggacccacttgcgagtgggacactgcagctgct
cacgcgattgttaaagctgcaggcggtcgttgtgtaattttcgatgaaaaaacaaactcc
gaaaccgaagacctgagctataacacaaaagagtctttgttgaatccgtattttattgtt
aaagggcctgttatcaatgaataa

DBGET integrated database retrieval system