KEGG   Kangiella koreensis: Kkor_0965Help
Entry
Kkor_0965         CDS       T00973                                 

Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
kko  Kangiella koreensis
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kko00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Kkor_0965
Enzymes [BR:kko01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Kkor_0965
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1016761..1017318)
Genome map
AA seq 185 aa AA seqDB search
MSDKLENLYREILVEIGEDISRNGILDTPKRAAKAMKFLTHGYEQDLNEVVNGAIFDSDN
DAMVIVKDIELYSMCEHHILPFIGKVHVGYLPTGKVIGLSKIARIVDMFARRLQIQENLT
KQIAHAVQDVTGASGVGVIVEAKHMCMMMRGVEKQNSVMTSSTMLGQFRTSQNTRQEFLT
LIEKR
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacaaattagaaaacctgtaccgcgaaatcctcgtcgagatcggtgaagatata
tcccgcaacggtattttagatactcccaaacgcgcagcaaaagcgatgaaattcctgact
cacggctatgagcaagatttgaacgaagtcgtcaatggcgcaattttcgattctgacaat
gatgccatggttattgttaaagacatcgagctttattcaatgtgcgagcaccatattttg
ccctttatcggcaaagtgcatgttggctacttaccaaccggcaaagtcatcggcctatcc
aaaattgctcgcatcgttgatatgtttgcacgccgcttgcagattcaggaaaacctgacc
aagcaaatcgctcacgcggttcaagatgtcaccggtgcttctggtgttggcgtgattgtg
gaagccaaacacatgtgcatgatgatgcgtggtgtggaaaagcaaaactctgtaatgacg
agttcaaccatgcttggccaattccgcacatcacaaaatactcgccaggaattcttaact
ctaattgagaaacgataa

DBGET integrated database retrieval system