KEGG   Kangiella koreensis: Kkor_0965Help
Entry
Kkor_0965         CDS       T00973                                 

Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
kko  Kangiella koreensis
Pathway
kko00790  Folate biosynthesis
kko01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kko00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Kkor_0965
Enzymes [BR:kko01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Kkor_0965
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF
Motif
Other DBs
NCBI-ProteinID: ACV26385
UniProt: C7RAU3
Position
complement(1016761..1017318)
Genome map
AA seq 185 aa AA seqDB search
MSDKLENLYREILVEIGEDISRNGILDTPKRAAKAMKFLTHGYEQDLNEVVNGAIFDSDN
DAMVIVKDIELYSMCEHHILPFIGKVHVGYLPTGKVIGLSKIARIVDMFARRLQIQENLT
KQIAHAVQDVTGASGVGVIVEAKHMCMMMRGVEKQNSVMTSSTMLGQFRTSQNTRQEFLT
LIEKR
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacaaattagaaaacctgtaccgcgaaatcctcgtcgagatcggtgaagatata
tcccgcaacggtattttagatactcccaaacgcgcagcaaaagcgatgaaattcctgact
cacggctatgagcaagatttgaacgaagtcgtcaatggcgcaattttcgattctgacaat
gatgccatggttattgttaaagacatcgagctttattcaatgtgcgagcaccatattttg
ccctttatcggcaaagtgcatgttggctacttaccaaccggcaaagtcatcggcctatcc
aaaattgctcgcatcgttgatatgtttgcacgccgcttgcagattcaggaaaacctgacc
aagcaaatcgctcacgcggttcaagatgtcaccggtgcttctggtgttggcgtgattgtg
gaagccaaacacatgtgcatgatgatgcgtggtgtggaaaagcaaaactctgtaatgacg
agttcaaccatgcttggccaattccgcacatcacaaaatactcgccaggaattcttaact
ctaattgagaaacgataa

DBGET integrated database retrieval system