KEGG   Kangiella koreensis: Kkor_1026Help
Entry
Kkor_1026         CDS       T00973                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
kko  Kangiella koreensis
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:kko00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Kkor_1026
DNA repair and recombination proteins [BR:kko03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Kkor_1026
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1078669..1079268
Genome map
AA seq 199 aa AA seqDB search
MQSPLIKKLIEAFTCLPGVGNKSAQRMAYFLLERNREGGEQLAEALVAAMNGVKHCSRCR
DFTEDDLCGICNSQARDNSLLCIVESPADVFAIESTASFKGKYFVLMGHLSPLDGIGPED
LGLDQLKRLVDEEKPVEIILATNSTVEGEATAHFISEMLKKNEVVLSRIASGVPLGGELE
YIDGGTLMHSLSGRQPYRR
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgcaatcaccgttgattaaaaaattgatcgaagcttttacctgtttgccgggagttggt
aacaaatcggcacaacgcatggcgtattttttgttagagcgtaaccgcgagggtggtgag
cagctagctgaagctttggttgctgcaatgaatggtgtgaagcactgttcgcgttgtcgt
gatttcaccgaagatgatttatgcggcatttgtaattctcaggcgcgtgacaatagtttg
ctctgtatagtggaaagccctgctgatgtgtttgccattgagtctaccgcaagctttaaa
gggaaatattttgttttaatggggcacttatcaccactcgacggtattgggcctgaagat
ttaggtctcgatcaattgaagcgtctggttgatgaggaaaagcctgtggaaattattttg
gcaactaactcaacagttgaaggtgaggccacagcacacttcatctccgaaatgttaaaa
aagaatgaggttgttttatcgcgtatagcatcgggtgttcctcttggtggtgagcttgag
tacatcgatggcggaaccttgatgcactcgctgtcagggcgtcaaccctatcgccgttag

DBGET integrated database retrieval system