KEGG   Kangiella koreensis: Kkor_1060Help
Entry
Kkor_1060         CDS       T00973                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
kko  Kangiella koreensis
Pathway
kko00071  Fatty acid degradation
kko00072  Synthesis and degradation of ketone bodies
kko00280  Valine, leucine and isoleucine degradation
kko00310  Lysine degradation
kko00362  Benzoate degradation
kko00380  Tryptophan metabolism
kko00620  Pyruvate metabolism
kko00630  Glyoxylate and dicarboxylate metabolism
kko00640  Propanoate metabolism
kko00650  Butanoate metabolism
kko00900  Terpenoid backbone biosynthesis
kko01100  Metabolic pathways
kko01110  Biosynthesis of secondary metabolites
kko01120  Microbial metabolism in diverse environments
kko01130  Biosynthesis of antibiotics
kko01200  Carbon metabolism
kko01212  Fatty acid metabolism
kko02020  Two-component system
Brite
KEGG Orthology (KO) [BR:kko00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Kkor_1060
   00630 Glyoxylate and dicarboxylate metabolism
    Kkor_1060
   00640 Propanoate metabolism
    Kkor_1060
   00650 Butanoate metabolism
    Kkor_1060
  Lipid metabolism
   00071 Fatty acid degradation
    Kkor_1060
   00072 Synthesis and degradation of ketone bodies
    Kkor_1060
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Kkor_1060
   00310 Lysine degradation
    Kkor_1060
   00380 Tryptophan metabolism
    Kkor_1060
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Kkor_1060
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Kkor_1060
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Kkor_1060
Enzymes [BR:kko01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Kkor_1060
Exosome [BR:kko04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Kkor_1060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt DUF5417 ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: ACV26479
UniProt: C7RB37
Position
complement(1118762..1119940)
Genome map
AA seq 392 aa AA seqDB search
MSDPIVIVSAARTPMGGFGGALSTVKSTELGATAIKAAVERAGIKADDVQEVIMGCVLPA
GVGQAPARQASLGAGLPQSTGATTVNKVCGSGMKTIMLAHDLLTAGTNDVMVAGGMESMS
LAPYLLPTGRYGQRFGHGKTLDHMAFDGLEDAYEGQAMGVYAEQTVEKYGFTREDQDAFA
IESLARANKAIEEGSFKSEITPVTVKSRKGDVEVDTDEQPLKARPDKIPALRPAFKKDGT
VTAANASSISDGAAAVVLMRQSEAEKRGLKPLAKIVAQSTNARIPAEFTIAPVGAIEKVL
DKAGWAKDDVDLFEINEAFAVVTMAAMKDLELDHAKVNVHGGACALGHPIGCSGTRIVVT
LIEALRKYGKSKGVASLCIGGGEATALAIELI
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgtcagatccaatcgtaatcgttagtgctgccagaaccccaatgggtggcttcggtggc
gcactgtccactgtaaaatcaactgaacttggcgctactgctatcaaagctgctgtggag
cgcgcaggcattaaagccgatgatgttcaagaagtcatcatgggctgtgtacttccggct
ggcgttggccaggctccagcacgtcaggcttcgcttggtgcaggcctaccacaatcaact
ggtgccactacagtaaacaaagtgtgtggttctggtatgaaaactatcatgctggcccat
gacttattaacagctggcactaatgacgtaatggttgctggtggtatggaaagcatgagt
cttgctccttaccttcttcctactggccgttatggtcagcgctttggccatggtaaaact
ttagaccatatggcttttgacggtcttgaagatgcttatgaaggtcaggcgatgggtgtt
tacgcagaacaaactgttgagaaatacggttttactcgcgaagatcaggatgcatttgcc
attgaatctttggcacgcgcgaataaagcaattgaagaaggttcattcaaaagtgaaatc
acaccggtcacggtcaaatctcgcaaaggtgatgttgaagtagatactgacgagcagcca
ttaaaagctcgccctgacaagatccctgcactacgccctgctttcaaaaaagacggtact
gtcactgcggctaatgccagctctatttctgatggtgccgcggcagttgtcttgatgcgt
caatccgaagctgaaaagcgtggcttgaaacctcttgccaaaattgttgcacaatcaacc
aatgctcgtattcctgctgaattcaccattgctcccgtcggcgcgattgaaaaagtattg
gataaagccggctgggcaaaagatgacgttgatttattcgaaattaacgaagcttttgcg
gtagtaactatggctgccatgaaagatttggaacttgatcacgctaaagtgaatgttcac
ggtggtgcctgcgcactaggtcacccaatcggttgttctggtacccgtattgttgttacc
ttgattgaagctttgcgtaagtatggtaagtcgaaaggcgttgcctctttatgcattggt
ggtggcgaagcaacagcactggccattgagcttatttaa

DBGET integrated database retrieval system