KEGG   Kangiella koreensis: Kkor_1310Help
Entry
Kkor_1310         CDS       T00973                                 

Definition
(GenBank) thymidine phosphorylase
  KO
K00758  thymidine phosphorylase [EC:2.4.2.4]
Organism
kko  Kangiella koreensis
Pathway
kko00240  Pyrimidine metabolism
kko01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kko00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Kkor_1310
Enzymes [BR:kko01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     Kkor_1310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_3 Glycos_trans_3N PYNP_C DUF2254
Motif
Other DBs
NCBI-ProteinID: ACV26726
UniProt: C7RBT4
Position
1407353..1408885
Genome map
AA seq 510 aa AA seqDB search
MIRQVNKGSHNQLKVVDIGINTHQEPVIYMREDCHICRSEGFTSSSRITVSSSTLSIVAS
LNVVDNHVLEQGYVGLSKVAMQRLKPDLNEMVTVGHADVVSSLTALRKKVFGNTLNYTEL
QAIITDISEHLYSDIEISSFLTVCAGGRLLPDEIIDLTKAMVNAGKSLRWPKYDQVLDKH
CIGGIPGNRTTPLVVSIVSAAGHIMPKTSSRAITSPAGTADTMETLTEVNLDLSAIQRVV
QETGACLCWGGAVNLSPADDLLIRIERALDLDGEGQLIASVLSKKIAAGSTHTIIDIPVG
DTAKVRNRESAERLANLFTKVGAACGIHVRCIITDGSKPIGSGIGPVEEARDLLAIFKRQ
QDASQELRERALLLASHLLDLAENCGLASGLERATSILESGKAYEQFKRILSAQGGGKSL
PSSRFQHVQPSSKSGTIVAIDNRKLARLAKLAGAPFTPVSGLRLHSNVGDSVTSQTPLFT
LFSDSQGELEYAMSYYNDNTDIFSISGRLQ
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgattcgtcaggtgaataaaggaagtcataaccagctgaaagttgtcgacattggaatt
aacactcatcaggagccagtgatttatatgcgtgaggattgccatatttgtcgctcagaa
ggtttcacatctagttcgcgaataactgttagttcttcaaccctctcaatagtggcaagc
ctcaacgttgttgataaccatgtattggaacaagggtatgtaggcttgtcgaaggttgcc
atgcaacgacttaaaccggatttgaatgagatggtaacagtggggcatgctgatgtggtc
agctcgttgacagctctacgcaaaaaggtttttggtaacacgcttaactatacggaacta
caggcgattattactgatatcagtgagcacctatatagtgatatcgagatctcaagcttt
ttgactgtgtgcgctggtggtcggttgctacccgatgaaatcattgacttgaccaaggct
atggtaaatgctggtaaaagtttacgttggcccaaatacgatcaggttttagacaaacac
tgtatcgggggtattccgggtaatcgaacgacccctctcgttgtttctattgttagtgcc
gcaggccatatcatgccaaaaacttcatcaagagctatcacttctccagctggcacagct
gacaccatggaaaccctaaccgaagtaaatctcgatctttccgctattcaacgtgtagtt
caggaaacgggcgcttgcctgtgctggggtggtgcagtcaatttaagtcctgccgacgat
ctgttaatcagaattgaacgtgctctagacttggatggtgaaggtcagctgattgcttca
gttctatctaaaaagattgctgctggctctacacataccattattgacatacccgtaggt
gacacagccaaagttcgaaaccgtgaatcggctgagcgattagctaatttatttaccaag
gtcggagctgcgtgtggtatccacgttcgttgcattattactgatggaagcaagcccatt
ggttctggtatcggccccgttgaagaagctcgtgatctacttgccatcttcaaacgtcaa
caggacgcctcccaggaactacgtgaacgagctttattattagcttctcacttacttgat
ctggccgaaaactgtggccttgcttctggactagaaagagctacgtcgatactggaaagt
ggcaaagcttatgaacaattcaaacgtattcttagcgcacaaggcgggggaaagtcactt
ccctcttcacggtttcagcatgttcaaccctcaagtaaaagtggcactattgtggctatt
gacaatcggaaactggcacgacttgctaaactagctggagcaccatttactccagtgtcc
ggccttagactccattccaatgttggcgatagtgttacctcccaaacacctttatttact
ttgtttagcgacagtcaaggtgagctcgaatatgcgatgtcgtattacaatgataatact
gatatattctcaattagcgggaggttacaatga

DBGET integrated database retrieval system