KEGG   Kangiella koreensis: Kkor_1364Help
Entry
Kkor_1364         CDS       T00973                                 

Definition
thymidine phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
kko  Kangiella koreensis
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kko00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Kkor_1364
Enzymes [BR:kko01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     Kkor_1364
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1457376..1458890
Genome map
AA seq 504 aa AA seqDB search
MDKTESILPVALRLGINSRHEPLIFLRSDSPVARSEGFESMSRVKVEVNNKTIIATLLIV
YSDLIKPGFAGLSETAWKRLNITEGQRIKLSHAPQVDSLAYIRAKAFGHELNKHQLQEIM
RDIVEGHYMDVHLAAFITACANNNMSHEEILYLTEAMVDAGETLTWPGDKIVDKHCVGGL
PGNRTSPIVVSILAAKGLTIPKTSSRAITSPAGTADVMETMTKVDLTFEQLKQVVEQHNG
CLAWGGSVSLSPADDILISVEKALDIDFEGQLIASILSKKIAAGSKYVLIDIPVGPTAKL
RSKESAQALAKQLKATGDEMGLKVKVVLTDGSQPVGYGIGPALEAWDVIGVLKNLNSAPQ
DLKERSVLLAGELLEHAEVVKPGEGLKEAQRVIESGEAWDKFTQICEAQGGFTEPPVGCC
KMNVNAYKTGYIRRINNRLLGRLAKLAGAPADHASGVYMEAKVGDFITEGSTLLAIHSEA
PGELEYALEFYNTHKEMIIIEEEL
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atggataaaactgaatcaatacttcctgtggctttgcggctagggatcaactcacgtcac
gaaccattaattttcttgcgttctgactctcctgttgcccgctcagaaggctttgaaagc
atgtctcgagtgaaagttgaagtcaataataaaactataattgcaaccttattaatcgtc
tatagcgatctcattaaacccggatttgcaggtctttctgaaactgcttggaagcgctta
aacattaccgagggtcaacgaataaaactttctcatgcccctcaagttgactcgcttgcc
tatattcgtgctaaagcttttggtcatgaattgaacaagcatcagttacaggaaatcatg
cgcgatatcgttgagggtcattacatggatgtgcatttagcggcattcattactgcctgc
gctaataacaatatgagccacgaggaaattctctatttaactgaggcaatggttgacgct
ggcgaaactctgacctggccgggagataaaatcgttgataaacattgtgtaggaggtttg
ccgggaaatcgcacctctcctatcgtagtatctattctggcggcaaaaggtttgacgatt
cctaaaacgtcttcgcgcgcgatcacttcaccagctggtactgcggatgtcatggagacc
atgacgaaagttgatttaacttttgaacaattgaaacaagttgttgagcaacataacggc
tgtcttgcctggggcggttcagtaagtttaagtcctgctgatgatattttgatcagtgtt
gaaaaagcattggatatagattttgaaggacaacttattgcttctattttatcgaaaaaa
attgctgccggatcaaagtatgtactgattgatattcctgtcggtccaactgcaaagctg
cgcagcaaagagagtgctcaggcacttgccaaacagttaaaagccactggcgatgagatg
ggcttaaaagttaaagtggtgttaaccgacggctcacaacctgtaggttacggtattggt
ccagcgctagaagcatgggatgttattggtgtattgaagaatttaaactccgccccgcaa
gacttaaaagaacgttcggtacttcttgccggagagttgctggaacatgctgaagtggtt
aaaccgggcgaaggactaaaggaagcgcagcgcgttatagagtcaggtgaggcctgggat
aagtttacgcaaatctgtgaagctcaaggaggctttacagagccacctgttggctgttgc
aagatgaatgtaaatgcatataaaaccggttatattcgacgtattaacaatcggctactg
ggtcgtcttgcgaagcttgcaggggcaccggcagatcatgcatccggagtctatatggaa
gccaaagttggcgactttataaccgagggctcgacattactggccattcattctgaggca
cccggtgagctggaatatgcgctagaattttataacacacacaaagaaatgattatcatc
gaggaagaattatga

DBGET integrated database retrieval system