KEGG   Kangiella koreensis: Kkor_1539Help
Entry
Kkor_1539         CDS       T00973                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
kko  Kangiella koreensis
Pathway
kko00020  Citrate cycle (TCA cycle)
kko00640  Propanoate metabolism
kko00660  C5-Branched dibasic acid metabolism
kko01100  Metabolic pathways
kko01110  Biosynthesis of secondary metabolites
kko01120  Microbial metabolism in diverse environments
kko01130  Biosynthesis of antibiotics
kko01200  Carbon metabolism
Module
kko_M00009  Citrate cycle (TCA cycle, Krebs cycle)
kko_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:kko00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Kkor_1539
   00640 Propanoate metabolism
    Kkor_1539
   00660 C5-Branched dibasic acid metabolism
    Kkor_1539
Enzymes [BR:kko01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Kkor_1539
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A ATP-grasp
Motif
Other DBs
NCBI-ProteinID: ACV26951
UniProt: C7RCF9
Position
complement(1656682..1657848)
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQGKQLFNEYGLPVSEGYAVDNPQSAFEAAGRIGGNVWVVKAQVHAGGRGKAGGV
KLVKTKEEVKDFAKQWLGKNLVTYQTDANGQPVSKILVEECTDIAQELYLGAVVDRSSRR
VVFMASTEGGVEIEKVAEETPEKILKATIDPLVGAQPYQGRELAFKLGLEGKQVKQFTHI
FLQLAKMFVEKDLALLEINPLVIKEDGDLHCLDAKINIDGNAMYRHPKLSEMHDPSQEDE
REAHAAKFELNYVALDGNIGCMVNGAGLAMGTMDIIKLHGGEPANFLDVGGGATKERVTE
AFKIILSDSNVKAVLVNIFGGIVRCDLIAEGIIGAVKEVGVKAPVVVRLEGNNAELGRKV
LAESGLNIIAAESLTDAATKVVAAAEDK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaacctacatgagtatcaaggtaaacagctttttaatgagtatggtttaccagtatcc
gagggttacgcggtagataatcctcagtctgcgtttgaagcagctggtcgcatcggtggc
aatgtgtgggtggttaaagcccaggtacatgccggtggtcgtggtaaagctggcggtgta
aaacttgttaagaccaaagaagaagttaaagattttgctaagcaatggcttggtaaaaat
ttggttacttaccaaaccgatgctaacggtcagccagttagcaaaattttagttgaagag
tgcaccgacattgctcaagaactttatttgggcgcagttgttgaccgttcaagccgtcgt
gttgtatttatggcttcaactgaaggtggtgttgaaatcgagaaagttgcagaagaaact
cctgagaagattcttaaagcaactatcgacccattggttggcgctcagccttaccagggc
cgtgaacttgcattcaagttaggcttggaaggcaaacaagttaagcaattcactcatatc
ttcttgcagcttgccaagatgtttgtggaaaaagatttggcacttcttgaaatcaatcca
ttggttattaaagaagatggcgacttgcattgtcttgatgccaaaatcaacatcgacgga
aacgcaatgtaccgtcatcctaaattatccgaaatgcacgacccttcgcaagaagatgag
cgcgaagctcatgcagctaagttcgaacttaactatgtagcacttgatggcaacatcggc
tgtatggttaatggtgctggtttggcaatgggtaccatggatatcattaagttgcatggt
ggtgagcctgctaacttcctagacgtgggcggtggcgctactaaagagcgtgtcacggaa
gcgtttaagattatcctttcagactctaacgtaaaagctgtattggttaatatctttggc
ggtattgttcgttgtgacttgattgctgaaggcattattggtgcggttaaagaagttggc
gttaaagctccagttgttgttcgtcttgaaggcaacaatgctgagttaggtagaaaggtt
ctagctgaatcaggtttgaacatcatcgcggcagaaagtttaactgatgcggctacaaaa
gtagttgctgcagcggaggacaaataa

DBGET integrated database retrieval system