KEGG   Kangiella koreensis: Kkor_1540Help
Entry
Kkor_1540         CDS       T00973                                 

Definition
2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
kko  Kangiella koreensis
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:kko00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Kkor_1540
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Kkor_1540
  Amino acid metabolism
   00310 Lysine degradation
    Kkor_1540
Enzymes [BR:kko01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Kkor_1540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1657969..1659219)
Genome map
AA seq 416 aa AA seqDB search
MAIEIKVPVLPESVADATIATWHVKPGESVSRDQNLVDIETDKVVLEVVAPDDGVISEII
KEEGDTVLQEEAIAKFEAGASGDAKADSSDEKKDDSSKESKKDDKEEAKSDKEEASSADL
DVLSPAVRRLVAEHNLDPKQIPASGKGGRLTKEDVEKFIKDGGASAKSSESKKDSGSAPV
SAGLREEKRVPMTRLRKRIAERLVEAQQTAAILTTFNDINMKEVVELRSRYKEQFEKVHG
TRLGFMSFFVKATVEALKRYPAVNASIDGDDIVYHGFYDIGVAVSSPRGLVVPVLRDADT
LSLAEIEAKIREFGVKARDNKLTVEDMTGGTFTISNGGVFGSLMATPIINPPQSAILGMN
RMEDRPVVINGEIVIRPMMNVALSYDHRIIDGRESVGFLKTIKEFIEDPARMLLDL
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgaaattaaagttcctgtgttacctgagtcagtagcagacgctactattgct
acatggcacgttaagccaggtgagtctgtatcacgtgaccaaaacttggttgatattgaa
acagataaagtcgttttagaggtggttgctccagatgatggcgtgatttctgaaatcatt
aaagaagagggcgacacagtacttcaggaagaagcaatcgctaagtttgaagcgggtgca
tcaggcgatgccaaagctgatagcagtgatgaaaagaaagatgactcttcaaaagagagc
aagaaagacgataaagaagaagcaaaatctgataaagaagaagcttcttctgcagacctg
gatgttctatcaccagcagtacgtcgtttggttgccgagcataaccttgatcctaagcag
attccagcgagtggcaaaggtggccgtttaaccaaagaagacgtagagaaatttattaag
gatggtggcgcttctgctaaatcatctgagagcaagaaagattctggttctgcgcctgta
tctgcaggtttgcgcgaagaaaagcgtgtcccaatgacgcgacttcgtaagcgtattgct
gagcgtttagtcgaagcgcagcaaacagcagcaattctaaccacgtttaatgatatcaat
atgaaagaagtggtagagctacgctcgcgctataaagaacagtttgagaaagttcatggc
acacgcttaggctttatgtcgttcttcgtgaaggcaacagttgaagcactaaaacgttat
ccggctgtcaacgcatcaattgatggagatgatattgtttatcacggcttctatgatatc
ggtgttgccgtttcttctccacgtggcttagttgtaccagttttgcgtgatgcagatact
ctgagtcttgctgaaattgaagctaagattcgtgagtttggcgtaaaagctcgtgataac
aagctaacagttgaagatatgaccggcggtacatttactatttcaaacggtggtgttttc
ggttcattaatggctacgcccattattaacccaccgcaaagtgctattcttggtatgaac
cgtatggaagatcgtcctgtggttataaatggcgagattgtgattcgtccgatgatgaat
gtcgcgctatcttatgaccatagaattattgatggacgcgagtctgtaggcttcttgaaa
acgattaaagaattcattgaagacccagctcgtatgttactggatttgtaa

DBGET integrated database retrieval system