KEGG   Kangiella koreensis: Kkor_1544Help
Entry
Kkor_1544         CDS       T00973                                 

Definition
(GenBank) succinate dehydrogenase, hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
kko  Kangiella koreensis
Pathway
kko00020  Citrate cycle (TCA cycle)
kko00190  Oxidative phosphorylation
kko00650  Butanoate metabolism
kko01100  Metabolic pathways
kko01110  Biosynthesis of secondary metabolites
kko01120  Microbial metabolism in diverse environments
kko01130  Biosynthesis of antibiotics
kko01200  Carbon metabolism
Module
kko_M00009  Citrate cycle (TCA cycle, Krebs cycle)
kko_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
kko_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:kko00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Kkor_1544
   00650 Butanoate metabolism
    Kkor_1544
  Energy metabolism
   00190 Oxidative phosphorylation
    Kkor_1544
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-ProteinID: ACV26956
UniProt: C7RCG4
Position
complement(1664879..1665232)
Genome map
AA seq 117 aa AA seqDB search
MGLVTASTSLGRSGLHDWIIQRVSALVMLAYVIYLGYFLCTTPELTFPVWQELFASTFMK
VFSLLALLSVIGHAWIGLWIVSTDYMPKLAIRFIFQVLVILICLTLLVWGIQILWSL
NT seq 354 nt NT seq  +upstreamnt  +downstreamnt
atgggcttagtaacagcatcaacaagtctaggtcgctcaggcttacatgactggattatc
cagcgagtatcagctctcgttatgctggcttatgtgatttacctgggttatttcttgtgc
acaactcctgaactgacgttcccggtatggcaagagttgtttgcatcgacctttatgaaa
gtattctctttactggcactcttgtcagtcattggacatgcttggattggtttgtggatt
gtgtccactgactatatgcctaaattggcaattcgtttcatcttccaagtattagtcatt
cttatctgtcttacactgttggtgtggggcattcagattttgtggagcctataa

DBGET integrated database retrieval system