KEGG   Kangiella koreensis: Kkor_1644Help
Entry
Kkor_1644         CDS       T00973                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase., Phosphoribosylanthranilate isomerase
  KO
K13498  indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
kko  Kangiella koreensis
Pathway
kko00400  Phenylalanine, tyrosine and tryptophan biosynthesis
kko01100  Metabolic pathways
kko01110  Biosynthesis of secondary metabolites
kko01130  Biosynthesis of antibiotics
kko01230  Biosynthesis of amino acids
Module
kko_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:kko00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Kkor_1644
Enzymes [BR:kko01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Kkor_1644
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     Kkor_1644
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS PRAI QRPTase_C FMN_dh
Motif
Other DBs
NCBI-ProteinID: ACV27056
UniProt: C7RCR4
Position
complement(1779452..1780912)
Genome map
AA seq 486 aa AA seqDB search
MLNVLETILEHKRSVIGNTADYHDLEPSQRSFYDALSKPHYGFIMECKKASPSKGLIRAK
FDLDQIVPVYDQYADAISVLTEERFFRGSFSNLQKVRKLTDKPLLCKDFILSPKQIRQAR
YFGADAVLLMLSVLNDKDYTICQEQAESLNMDVLTEVHTEAELERAIKLGAKIIGINNRN
LKDLSTSFEHTQALAKKIPADRLVVTESGINTHQDVLDLSQFSDACLVGSSLMKEDDLEL
AARQLVYGDIKVCGVTQQSDADLLQELPASCVGVIFVPNSKRCVDSNIITSSKPLIGVFQ
DQSIDEVVSAAQQYRLQAVQLHGDESLDFAQAIKQQVTDIKVSKVFHVGPEISSEIFEKE
LKTLLDTYDEVLLDTEVTNSTQNQRGGTGVSFDWSLLRNLNPQLFSQKLRIAGGVNAENI
QNLKQLGVINVDLSSSVESSPGVKGKDLLAYFFRAARPQSGRNQFNSADREVDNNLNPVA
VGGISS
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgcttaatgtattagaaactatccttgaacataagcgtagtgtgattggtaacacagct
gactatcatgatttagagcctagtcaacgaagcttttatgatgcactcagtaagccacat
tacggttttattatggagtgtaagaaagcatcgccttccaaagggctaattcgtgccaag
tttgatttagaccaaattgtgccagtttatgaccaatatgcagatgccatttcagtactc
actgaagagcgattttttcgtggcagtttttccaatctacagaaagtaagaaagcttacc
gataagcctttactgtgcaaagatttcatcttgtcgccaaagcaaattcgtcaggcgcgt
tactttggagctgatgccgttttgttaatgctgtcagttcttaatgataaagactataca
atttgtcaggagcaggccgaaagtttaaacatggatgtgctgaccgaagttcatacagaa
gcagagctggagcgagcgataaagcttggagctaagattattggcatcaacaaccgaaac
ctcaaagatttatcaaccagtttcgagcacactcaggcactcgcaaaaaaaatacctgcg
gaccgtttggtggtcactgaatctggtattaatacccaccaagatgtattagacctttct
cagttttcagatgcctgtttggtaggttccagtctgatgaaggaagatgacttggagtta
gcggcacggcaactggtatatggcgacattaaagtttgcggtgtgacgcaacaatctgat
gctgatctcttgcaagaacttccagccagttgtgtcggtgtgattttcgtgccgaattca
aaacgttgtgttgatagcaacataataacttcctcaaaacctctgatcggagtttttcaa
gatcagtccattgatgaggttgtgtctgctgctcagcaatacagactgcaagccgtacag
ctacatggtgatgaaagtttagactttgctcaagccattaagcagcaagttactgatatt
aaagtatccaaagtttttcatgttggacctgaaatatcatcagagatttttgaaaaagaa
ctgaagactttacttgatacctatgacgaagttttgctggatacagaagtgaccaattca
acacaaaatcaacggggtggaaccggtgtcagttttgattggtcattactacgcaatctg
aatccacaattatttagccagaaactgcgaattgccggtggtgtaaacgcagagaacatt
caaaatcttaaacagctaggtgtcatcaacgttgatctgtccagctcggttgagtccagt
cctggagtcaaaggtaaggatttgctggcatactttttcagagctgcccgaccacagtct
ggtcgtaaccaatttaattctgcagaccgtgaggtggataataatctaaacccggtcgct
gttggaggtatttcatcatga

DBGET integrated database retrieval system