KEGG   Kangiella koreensis: Kkor_1863Help
Entry
Kkor_1863         CDS       T00973                                 

Definition
(GenBank) Holliday junction DNA helicase RuvA
  KO
K03550  holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
kko  Kangiella koreensis
Pathway
kko03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:kko00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Kkor_1863
Enzymes [BR:kko01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Kkor_1863
DNA repair and recombination proteins [BR:kko03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     Kkor_1863
    RecFOR pathway proteins
     Kkor_1863
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HHH_5 RuvA_N RuvA_C HHH IMS_HHH HHH_2 5_3_exonuc Transposase_20
Motif
Other DBs
NCBI-ProteinID: ACV27275
UniProt: C7R5V1
Position
complement(2012397..2013014)
Genome map
AA seq 205 aa AA seqDB search
MIGRIRGTLIEKIPPFVIIETTAGVGYEIQVPMTTFYQLPEEGEQAILSTHMSIAENLHA
LYGFISTKDRALFRELIKVNGVGPKLALAILSGMETDEFVMTVHDGNVDRLVKLPGVGKK
TAERLLVEMSDRLKDWSISAGLPSSQPSEASIAQTAKTDASQEAVSALIALGYKPQIASK
AVTQVAHDDAKSEELIRLALRQLAS
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
ttgatcggaagaatacgcggtacattaatcgaaaaaatccctccctttgtcatcatcgaa
accactgccggtgtcggttacgaaattcaggtgccgatgacgactttttatcagttgccg
gaagagggtgagcaagccattctttcaacacatatgtcgatagctgaaaacttacatgcg
ctctatggttttatcagtactaaagatagggccttgtttcgtgagttgattaaagtgaat
ggtgttgggcctaagctagcactggccattttatcaggtatggaaacagatgaatttgtg
atgacggtgcatgatggcaatgtggataggttagtaaagttaccaggtgtcggtaagaaa
actgcagaacgcctattagttgaaatgtctgatcgcttgaaggactggtcaatatctgca
ggcttaccatctagccaaccatctgaagcaagtattgcgcaaacagcaaaaactgatgcg
tcgcaagaggcggtcagtgctttgattgctttaggctataaaccacaaatcgccagcaag
gccgtaactcaggttgctcacgatgatgctaagagcgaagaacttattcgtttggccttg
agacagttggcgagttag

DBGET integrated database retrieval system