KEGG   Kangiella koreensis: Kkor_2012Help
Entry
Kkor_2012         CDS       T00973                                 

Definition
protein-L-isoaspartate(D-aspartate)O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
kko  Kangiella koreensis
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2176129..2176797
Genome map
AA seq 222 aa AA seqDB search
MEQPIFDLEQARQNMVEQQIRPWNVLDNQLLDLISGLPRDRFVPEEFRSLAYADTQIPLG
HSQCMMPPREEARMLQALRIQPSDIVLEIGTGTGYCTALMAQLAHKVYSVDIIGEFIEQA
KERTQELGLDNIEFEEGDAAAGWPHYKPYDVIAITGSFYKLPKALKRHLPIGGRLFCVVG
QEPAMKAELITRIGDDEWHEEVLFETVLPYLINAKRAEQFEF
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atggagcagccgatatttgatttggaacaggctcgacaaaatatggttgaacagcaaatc
cgtccatggaatgtgctggataatcagttactggatttgatttctggcttaccgcgcgac
agatttgtacctgaagaatttcgctcgctggcctacgcagacacacagattccacttggt
catagccaatgcatgatgcctcctcgtgaagaagctagaatgttacaggcattacgtatt
cagcccagtgatatagtgttagaaataggtaccggcacaggctactgcactgccttgatg
gcacaattggcgcacaaagtttatagcgtggacatcattggcgagtttattgaacaggca
aaagagcgtacccaagaattaggactcgataatattgagtttgaagaaggtgatgcggca
gctggctggcctcattacaagccttatgatgttattgccattaccggtagcttttataaa
ttacccaaagcactcaagcgccacctgcctatcggtggccgcctgttttgcgtagtcggt
caggagcctgcgatgaaggcagaactcatcacccgaattggtgatgatgaatggcacgaa
gaagtattgttcgaaaccgttttgccctatttaatcaacgcaaaacgtgccgaacagttt
gagttttaa

DBGET integrated database retrieval system