KEGG   Kangiella koreensis: Kkor_2050Help
Entry
Kkor_2050         CDS       T00973                                 

Definition
asparagine synthase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
kko  Kangiella koreensis
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:kko00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Kkor_2050
Enzymes [BR:kko01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Kkor_2050
Peptidases [BR:kko01002]
 Cysteine Peptidases
  Family C44
   Kkor_2050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2220337..2222349)
Genome map
AA seq 670 aa AA seqDB search
MCGIAGVIHRDKDRTIDAQTLVNMAAIQYHRGPDNFGYYNPEGVGVGMSHARLTIIDLDE
ERGRQPLVSDDQRYMMVHNGEFYDFQRIRADMTAQGARYQTKSDSELVLQMYPHYGIEKT
VENLRGEFAFSIYDREEETMYLVRDRFGIKPLYWTETEHGVVFGSELKVLFAHPEVKREI
DSEGLYHQLIQVMIPGSTAFKGVKQVPPGHWIKIQRRNGKLEISEHKYWDIDFPQAEAHL
NVKDEQEYIDGVRENLLEAVQHRLNADVPVGAYLSGGIDSCSILGLSASVRQDPVKAFTI
GFDDADYDETPIAREMAEMTGAEQIILPLSAEHLYDHFERTIWHTERTIYNTLGVAKLLM
SQKVREQGYKVVLTGEGSDELFAGYPAFRNDMFLYGLDDLPENLRKEMQSTLAESNKLFK
GAMLPREAFRSDAIDSKVGFTPTCIQNWMGCDGYARNLMNKDHQANINDYDPGTAMAEQF
DESQLEGRHPLDKAQYVWIKTMLEGQILTWGGDRVDMANSMEARPPFLDHHLAAYAVNIP
PQMRIKGPVEKYVLKEAMKGLLPETLYKRQKFAFMAPPAHTDKKKWNALMELMEEFASEE
KVAEAGLIDYGVLQDMIKKNDDPTVPREDKVQMDAILNHVLGVQLLHHHFIENDVPKMAA
AKAHELGWVA
NT seq 2013 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggtattgccggtgtaattcatcgtgacaaagatcgaactattgatgcacaaacg
ctcgtcaacatggcggccattcaatatcaccgaggccctgataacttcggttattacaat
cccgaaggtgttggcgttggtatgagccatgcgcgactgactattatcgatctggatgaa
gaacgcgggcgccagccattggtcagtgatgaccaacgttacatgatggtgcataacggt
gagttctatgacttccagcgcattcgtgccgatatgaccgcacagggcgctcgttatcaa
actaagagtgactctgaactggtgctgcaaatgtatccgcactatggcattgaaaaaacg
gtagaaaacttgcgtggtgagtttgctttttcaatatatgaccgcgaagaagaaaccatg
tatctggtacgtgaccgtttcggtatcaagcctttgtattggactgaaactgaacacggc
gtagtgtttggttctgaactgaaagttctgttcgcacatcctgaagtaaagcgtgaaatt
gactctgaaggtttataccatcagctgattcaggtgatgattcccggttctaccgctttc
aaaggtgttaaacaagttcctccgggtcactggatcaaaatccaacgtcgtaatggcaag
ctggaaatatccgagcataaatattgggacatagatttcccacaagctgaagctcatttg
aatgtcaaagatgagcaggaatacattgatggtgtgcgtgagaatctacttgaagcagtt
caacatcgcttgaatgcagacgttcccgttggtgcttatttatccggtggtatcgattcc
tgttcgattcttggtttgtctgcctcggtgcgtcaggatccggtaaaagcttttacaatt
ggctttgatgatgctgattatgatgaaacaccgatcgcccgcgaaatggcggagatgaca
ggcgcagaacaaatcattctgccactgtcagctgaacatctgtatgaccatttcgagcgt
actatctggcatacggaacgaaccatctacaatacgctgggtgtggccaaattattgatg
agtcagaaggttcgtgaacagggctataaagtggtcttgaccggcgagggcagtgatgaa
ttatttgctggctatcctgcattccgaaatgacatgttcttatatggtttagatgacctg
ccggaaaacctgcgcaaagagatgcaatcaactctggccgaatcaaacaagttattcaag
ggcgccatgttgccgcgagaagcattccgctcagatgcgattgactcgaaagttggcttc
acaccaacctgtatccagaattggatgggctgtgatggatatgcgcgtaacttaatgaat
aaagatcatcaagccaatatcaacgactatgacccaggcacagcaatggccgaacaattt
gatgaaagccagctggaaggtcgtcatccgctggataaggcgcaatacgtctggattaaa
actatgctcgaaggtcagattctaacctggggtggtgatcgtgtagatatggccaactca
atggaagcgcgcccaccattccttgatcatcacctcgcagcctacgcagtcaatattcca
ccacaaatgcgtatcaaaggtcctgtcgagaaatatgtgctgaaagaagcgatgaaaggt
ttgctgcctgaaacattatacaagcgtcaaaagttcgccttcatggcaccgcctgcgcat
accgacaagaaaaaatggaatgcacttatggagctgatggaagagtttgccagcgaagaa
aaagtcgcagaagcaggattgattgattacggtgtattgcaggatatgatcaagaaaaat
gatgatccaactgttccgcgcgaagataaagtacagatggacgccatcctcaatcacgta
ctgggtgtacaactattgcatcatcatttcattgaaaatgacgtgcccaaaatggcagcg
gcaaaagcccatgaactgggttgggttgcttaa

DBGET integrated database retrieval system