KEGG   Kangiella koreensis: Kkor_2353Help
Entry
Kkor_2353         CDS       T00973                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
kko  Kangiella koreensis
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:kko00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Kkor_2353
   01230 Biosynthesis of amino acids
    Kkor_2353
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Kkor_2353
   00051 Fructose and mannose metabolism
    Kkor_2353
   00562 Inositol phosphate metabolism
    Kkor_2353
Enzymes [BR:kko01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Kkor_2353
Exosome [BR:kko04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Kkor_2353
  Exosomal proteins of bladder cancer cells
   Kkor_2353
  Exosomal proteins of melanoma cells
   Kkor_2353
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2550965..2551717)
Genome map
AA seq 250 aa AA seqDB search
MRTKLIAGNWKMHGSKPFIESLMKGMTEQLDASLESDVLVCPPTIYIPFVESLIGDHKIA
LGGQNLSEQAQGAYTGEVSGDMLKDNGCQYVIVGHSERRSLYGEMDVLVAHKVGKAIESE
LTPILCVGETLEQREKGTTMQVVQQQLDAVIDALGIDALQQVVVAYEPVWAIGTGVTASP
EQAQEVHSAIRAHLRDKNAQIAEEIKILYGGSMKAANAEELLAQPDIDGGLIGGASLKAD
EFIAICKIAG
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
gtgcgtactaagctcatcgcaggcaactggaaaatgcacggtagtaagccattcattgag
tcattgatgaagggtatgactgagcagttggatgcgagtctggaaagtgacgttctggtg
tgccctcctactatttatataccttttgttgagagcctgatcggtgatcataagattgcc
ttaggtggtcagaatctcagcgaacaagcacaaggcgcctatactggtgaagtcagtggc
gacatgcttaaagataatggttgccagtatgtgatcgtgggccattccgaacgacgtagc
ctgtatggtgaaatggacgttttggtcgcgcataaagttggcaaggcaattgaatctgaa
ttaacgcctattctttgtgtgggtgagacccttgaacaaagagaaaaaggcaccactatg
caagtagtgcagcagcaactggacgcggttattgatgccttaggtatcgatgcattacaa
caggtagttgtagcctatgagcctgtatgggcaataggcacaggcgtaaccgcatctcct
gagcaagctcaggaagtacattcagcaattcgagctcatttacgtgataagaatgctcaa
attgctgaagaaattaaaatactctatggcggcagtatgaaagcggccaatgctgaagaa
ttgttggctcagcctgatatcgatggcggattgattggcggggcttctttaaaagcagat
gaatttatcgcgatttgcaaaatagcaggataa

DBGET integrated database retrieval system