KEGG   Kangiella koreensis: Kkor_2353Help
Entry
Kkor_2353         CDS       T00973                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
kko  Kangiella koreensis
Pathway
kko00010  Glycolysis / Gluconeogenesis
kko00051  Fructose and mannose metabolism
kko00562  Inositol phosphate metabolism
kko01100  Metabolic pathways
kko01110  Biosynthesis of secondary metabolites
kko01120  Microbial metabolism in diverse environments
kko01130  Biosynthesis of antibiotics
kko01200  Carbon metabolism
kko01230  Biosynthesis of amino acids
Module
kko_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:kko00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Kkor_2353
   00051 Fructose and mannose metabolism
    Kkor_2353
   00562 Inositol phosphate metabolism
    Kkor_2353
Enzymes [BR:kko01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Kkor_2353
Exosome [BR:kko04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Kkor_2353
  Exosomal proteins of bladder cancer cells
   Kkor_2353
  Exosomal proteins of melanoma cells
   Kkor_2353
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM ArAE_2
Motif
Other DBs
NCBI-ProteinID: ACV27762
UniProt: C7R8J7
Position
complement(2550965..2551717)
Genome map
AA seq 250 aa AA seqDB search
MRTKLIAGNWKMHGSKPFIESLMKGMTEQLDASLESDVLVCPPTIYIPFVESLIGDHKIA
LGGQNLSEQAQGAYTGEVSGDMLKDNGCQYVIVGHSERRSLYGEMDVLVAHKVGKAIESE
LTPILCVGETLEQREKGTTMQVVQQQLDAVIDALGIDALQQVVVAYEPVWAIGTGVTASP
EQAQEVHSAIRAHLRDKNAQIAEEIKILYGGSMKAANAEELLAQPDIDGGLIGGASLKAD
EFIAICKIAG
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
gtgcgtactaagctcatcgcaggcaactggaaaatgcacggtagtaagccattcattgag
tcattgatgaagggtatgactgagcagttggatgcgagtctggaaagtgacgttctggtg
tgccctcctactatttatataccttttgttgagagcctgatcggtgatcataagattgcc
ttaggtggtcagaatctcagcgaacaagcacaaggcgcctatactggtgaagtcagtggc
gacatgcttaaagataatggttgccagtatgtgatcgtgggccattccgaacgacgtagc
ctgtatggtgaaatggacgttttggtcgcgcataaagttggcaaggcaattgaatctgaa
ttaacgcctattctttgtgtgggtgagacccttgaacaaagagaaaaaggcaccactatg
caagtagtgcagcagcaactggacgcggttattgatgccttaggtatcgatgcattacaa
caggtagttgtagcctatgagcctgtatgggcaataggcacaggcgtaaccgcatctcct
gagcaagctcaggaagtacattcagcaattcgagctcatttacgtgataagaatgctcaa
attgctgaagaaattaaaatactctatggcggcagtatgaaagcggccaatgctgaagaa
ttgttggctcagcctgatatcgatggcggattgattggcggggcttctttaaaagcagat
gaatttatcgcgatttgcaaaatagcaggataa

DBGET integrated database retrieval system