KEGG   Kangiella koreensis: Kkor_2378Help
Entry
Kkor_2378         CDS       T00973                                 

Definition
(GenBank) Stearoyl-CoA 9-desaturase
  KO
K00507  stearoyl-CoA desaturase (Delta-9 desaturase) [EC:1.14.19.1]
Organism
kko  Kangiella koreensis
Pathway
kko01040  Biosynthesis of unsaturated fatty acids
kko01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:kko00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Kkor_2378
Enzymes [BR:kko01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     Kkor_2378
Lipid biosynthesis proteins [BR:kko01004]
 Desaturase
  First
   Kkor_2378
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FA_desaturase
Motif
Other DBs
NCBI-ProteinID: ACV27787
UniProt: C7R8Z7
Position
complement(2574946..2575857)
Genome map
AA seq 303 aa AA seqDB search
MKMKQWFDNSQINTQTGQPEQLEGIDWPRVIPYIGLHLVCLFAFVTGVSWAAIIVCIAAY
MIRMFAITAFYHRYFSHKSFKTYRWVQALFGFLGASATQRGPLWWAAHHRHHHIHADTAE
DTHSPRHGFLKSHMLWFLNKKNFPTQEQRVKDLARYPELRWLDRFDIFPPIIFASLIFGL
GIYLEKFHPSLGADRWQILIWGFFISTILLSHVTYCINSLAHRWGTKRFETNDDSRNNFL
LALFTLGEGWHNNHHFSPGSVKQGFYWWEIDLSYYVLKGMEKVGLVWDLKYPDKQLIKAK
AKS
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatgaaacaatggtttgataacagtcaaatcaatacccaaacaggtcagccagaa
caactggaaggcatcgattggccaagagttataccctatatcggattgcatctagtatgc
ttgtttgcctttgtcacaggcgtgtcctgggcagctataatagtctgtatcgcagcctac
atgatacgcatgttcgccatcaccgctttttatcaccgttacttttcccacaaaagcttt
aagacgtaccgctgggtacaagctctatttggatttctaggtgcctcagctactcaacga
ggtccattgtggtgggccgcgcatcatcggcatcaccatattcacgcagatactgctgaa
gacacccactcgccaagacacggtttcttaaaaagtcatatgctgtggtttctgaacaaa
aagaattttcctacccaagagcaacgagttaaagatttagctcgatacccagagttaagg
tggctggatcgatttgatatctttccaccgataatttttgccagccttatttttggcctg
ggtatctatctagaaaagtttcatccttcattgggagccgatcgttggcagattctaatc
tggggcttcttcatttcaaccattctattatcgcatgttacttactgcataaactcttta
gcacatcgctggggcactaagcgttttgaaaccaatgatgacagccgtaataacttttta
ttggcattatttacgctaggtgaagggtggcataacaaccatcatttcagcccaggctcg
gttaagcagggattttattggtgggaaattgatttaagttactatgtgcttaaaggtatg
gaaaaagttggcttggtctgggatctgaagtatcccgacaaacaattaattaaagcgaag
gcaaaatcatga

DBGET integrated database retrieval system