KEGG   Kangiella koreensis: Kkor_2415Help
Entry
Kkor_2415         CDS       T00973                                 

Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
kko  Kangiella koreensis
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kko00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Kkor_2415
   00670 One carbon pool by folate
    Kkor_2415
Enzymes [BR:kko01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     Kkor_2415
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2610505..2611020
Genome map
AA seq 171 aa AA seqDB search
MMSKPIISLVVAMANDRVIGKDNQMPWHLPADLKHFKAVTLGKPVIMGRKTHESIGMVLP
GRHNIIISRNPDYRSQFHNERCQVVTSLEQAFEAAGEAQEVMIIGGSNIYHQMIDQADKL
YLTFIDLDTDGDAHFPDWTHLEWKEVSRDKHQPDEKNPYHYQFVELERVSA
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atgatgagtaaaccgattatcagcttagtagttgccatggctaatgaccgcgttattggc
aaagataaccagatgccgtggcacctgcccgctgatctgaaacacttcaaagcagtcact
ttaggcaagccggtcatcatgggtcgtaaaactcatgagtcaattggcatggtgctgccc
ggtcgccacaatatcatcatcagccgcaatccagactaccgctcgcaatttcataatgag
cgctgccaagttgtgaccagtcttgagcaggcattcgaagcggcaggcgaagctcaagaa
gtaatgatcatcggtggctccaatatctaccatcaaatgatcgaccaggctgataagctc
tacctaaccttcattgatctggatacagacggcgatgcacacttccccgactggacgcac
ttagaatggaaagaagtctcccgcgacaaacatcagccagatgaaaaaaatccctatcat
tatcagtttgtagaattagaaagagttagtgcataa

DBGET integrated database retrieval system