KEGG   Kangiella koreensis: Kkor_2429Help
Entry
Kkor_2429         CDS       T00973                                 

Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
kko  Kangiella koreensis
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:kko00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Kkor_2429
Enzymes [BR:kko01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Kkor_2429
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2625523..2626176)
Genome map
AA seq 217 aa AA seqDB search
MTTMTPINTIAKGTLYVVSAPSGAGKTSLLKAVLQKLPELKLSISHTTRPQRPGEQDGVD
YHFVDQATFQKMLDEQQFLEHAEVFGNFYGTSRAWLEQQLVEGHDVILEIDWQGARQVRE
LMPECRGIFILPPSREELSNRLTNRGQDSDEVIAKRMAAATAEMKHYDEYDYVLVNDDFE
TACEELEAIYTARRLRTASQKVRQHHLIHDLLSDSME
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgacgactatgacgcctatcaacaccatcgctaaaggtacgctttatgtagtttcggcg
ccttccggggcgggtaaaaccagtctgttgaaggctgttttgcagaagttacccgaactt
aagctatctatttcgcatacaactcgcccgcaaagaccgggggagcaggatggcgtggat
tatcattttgttgatcaggcgactttccagaagatgttggatgagcagcaatttttagaa
catgccgaggtgtttggcaacttttacggcaccagtcgcgcctggctggagcagcagttg
gtcgagggacatgatgtgattctggagattgactggcagggtgcgcgccaagtacgtgag
ttgatgccagaatgtcgcggtatctttattctgccgccatcgcgggaagagctatcaaat
cgtctgacaaatcgcggccaggatagcgatgaagtgatcgctaaacgtatggcagcggca
actgcagaaatgaaacactatgatgagtacgattatgtactcgtcaatgatgactttgag
acggcttgcgaggagttggaggcgatttatactgctcgacgcctgcgcactgccagccaa
aaggttcgtcaacaccatttaattcatgacctgctatcagattctatggagtaa

DBGET integrated database retrieval system