KEGG   Kangiella koreensis: Kkor_2473Help
Entry
Kkor_2473         CDS       T00973                                 

Definition
ribose 5-phosphate isomerase
Orthology
K01807  
ribose 5-phosphate isomerase A [EC:5.3.1.6]
Organism
kko  Kangiella koreensis
Pathway
Pentose phosphate pathway
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:kko00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Kkor_2473
   01230 Biosynthesis of amino acids
    Kkor_2473
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Kkor_2473
Enzymes [BR:kko01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.6  ribose-5-phosphate isomerase
     Kkor_2473
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2665841..2666500
Genome map
AA seq 219 aa AA seqDB search
MTQDELKKLVGEAALEYVVDDSIVGVGTGSTVNYFIDALATMKHKIKGAVSSSEASTERL
KKHGIEVFELNEVGKLPVYVDGADESNHLLELIKGGGGALTREKIIAAAADQFICIADES
KLVRRLGEFPLPVEVIPMARSYVARQIVKLGGDPVYRTGFVTDNGNVILDVHGLVINEPI
KLERILNNIVGVVTNGLFAERAADVLLLGKEGKVETITR
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgacacaggacgaattaaagaagttagtgggtgaagccgcgcttgaatatgtggtcgac
gattcgattgttggcgtgggaactggctccaccgtcaactattttattgatgcgctggcg
acgatgaaacacaaaatcaaaggtgcagtgtccagctctgaagcatcaaccgagcgttta
aagaagcacggtattgaagtattcgaactcaacgaagtgggcaagctcccagtctacgta
gatggcgcagacgaatccaaccatctattggagctgattaaaggtggtggcggcgccctg
acccgtgaaaaaattatcgcagcagctgccgatcaattcatctgcatcgctgacgagtct
aagctggttcgtcgcttgggtgaattcccgttaccagtagaagttatcccaatggcgcgt
agttatgtcgcacgccaaatcgtaaaactaggtggcgacccggtttatcgtacaggcttt
gtcactgataacggcaacgttattcttgatgtgcatggtctggttattaatgagcccatc
aagcttgaacgaattcttaataatatcgttggtgttgtgactaatggtttatttgcggaa
agagcagccgatgtattgttgctgggtaaagaaggtaaagtggaaacgataacgcgttag

DBGET integrated database retrieval system