KEGG   Kangiella koreensis: Kkor_2473Help
Entry
Kkor_2473         CDS       T00973                                 

Definition
(RefSeq) ribose 5-phosphate isomerase
  KO
K01807  
ribose 5-phosphate isomerase A [EC:5.3.1.6]
Organism
kko  Kangiella koreensis
Pathway
Pentose phosphate pathway
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:kko00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Kkor_2473
   01230 Biosynthesis of amino acids
    Kkor_2473
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Kkor_2473
Enzymes [BR:kko01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.6  ribose-5-phosphate isomerase
     Kkor_2473
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2665841..2666500
Genome map
AA seq 219 aa AA seqDB search
MTQDELKKLVGEAALEYVVDDSIVGVGTGSTVNYFIDALATMKHKIKGAVSSSEASTERL
KKHGIEVFELNEVGKLPVYVDGADESNHLLELIKGGGGALTREKIIAAAADQFICIADES
KLVRRLGEFPLPVEVIPMARSYVARQIVKLGGDPVYRTGFVTDNGNVILDVHGLVINEPI
KLERILNNIVGVVTNGLFAERAADVLLLGKEGKVETITR
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgacacaggacgaattaaagaagttagtgggtgaagccgcgcttgaatatgtggtcgac
gattcgattgttggcgtgggaactggctccaccgtcaactattttattgatgcgctggcg
acgatgaaacacaaaatcaaaggtgcagtgtccagctctgaagcatcaaccgagcgttta
aagaagcacggtattgaagtattcgaactcaacgaagtgggcaagctcccagtctacgta
gatggcgcagacgaatccaaccatctattggagctgattaaaggtggtggcggcgccctg
acccgtgaaaaaattatcgcagcagctgccgatcaattcatctgcatcgctgacgagtct
aagctggttcgtcgcttgggtgaattcccgttaccagtagaagttatcccaatggcgcgt
agttatgtcgcacgccaaatcgtaaaactaggtggcgacccggtttatcgtacaggcttt
gtcactgataacggcaacgttattcttgatgtgcatggtctggttattaatgagcccatc
aagcttgaacgaattcttaataatatcgttggtgttgtgactaatggtttatttgcggaa
agagcagccgatgtattgttgctgggtaaagaaggtaaagtggaaacgataacgcgttag

DBGET integrated database retrieval system