KEGG   Kangiella koreensis: Kkor_2473Help
Entry
Kkor_2473         CDS       T00973                                 

Definition
(GenBank) ribose 5-phosphate isomerase
  KO
K01807  ribose 5-phosphate isomerase A [EC:5.3.1.6]
Organism
kko  Kangiella koreensis
Pathway
kko00030  Pentose phosphate pathway
kko01100  Metabolic pathways
kko01110  Biosynthesis of secondary metabolites
kko01120  Microbial metabolism in diverse environments
kko01130  Biosynthesis of antibiotics
kko01200  Carbon metabolism
kko01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:kko00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Kkor_2473
Enzymes [BR:kko01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.6  ribose-5-phosphate isomerase
     Kkor_2473
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rib_5-P_isom_A DeoRC Sugar-bind RNase_PH_C
Motif
Other DBs
NCBI-ProteinID: ACV27882
UniProt: C7R992
Position
2665841..2666500
Genome map
AA seq 219 aa AA seqDB search
MTQDELKKLVGEAALEYVVDDSIVGVGTGSTVNYFIDALATMKHKIKGAVSSSEASTERL
KKHGIEVFELNEVGKLPVYVDGADESNHLLELIKGGGGALTREKIIAAAADQFICIADES
KLVRRLGEFPLPVEVIPMARSYVARQIVKLGGDPVYRTGFVTDNGNVILDVHGLVINEPI
KLERILNNIVGVVTNGLFAERAADVLLLGKEGKVETITR
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgacacaggacgaattaaagaagttagtgggtgaagccgcgcttgaatatgtggtcgac
gattcgattgttggcgtgggaactggctccaccgtcaactattttattgatgcgctggcg
acgatgaaacacaaaatcaaaggtgcagtgtccagctctgaagcatcaaccgagcgttta
aagaagcacggtattgaagtattcgaactcaacgaagtgggcaagctcccagtctacgta
gatggcgcagacgaatccaaccatctattggagctgattaaaggtggtggcggcgccctg
acccgtgaaaaaattatcgcagcagctgccgatcaattcatctgcatcgctgacgagtct
aagctggttcgtcgcttgggtgaattcccgttaccagtagaagttatcccaatggcgcgt
agttatgtcgcacgccaaatcgtaaaactaggtggcgacccggtttatcgtacaggcttt
gtcactgataacggcaacgttattcttgatgtgcatggtctggttattaatgagcccatc
aagcttgaacgaattcttaataatatcgttggtgttgtgactaatggtttatttgcggaa
agagcagccgatgtattgttgctgggtaaagaaggtaaagtggaaacgataacgcgttag

DBGET integrated database retrieval system