KEGG   Kluyveromyces lactis: KLLA0A00396gHelp
Entry
KLLA0A00396g      CDS       T01025                                 

Definition
hypothetical protein
Orthology
K11871  
ubiquitin carboxyl-terminal hydrolase 7/11 [EC:3.4.19.12]
Organism
kla  Kluyveromyces lactis
Brite
Enzymes [BR:kla01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     KLLA0A00396g
Peptidases [BR:kla01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   KLLA0A00396g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
A:29717..32755
Genome map
AA seq 1012 aa AA seqDB search
MSRLYTPEYSDELLSFVQEVYSQDVKHYYAKLKLEKLIELLEQAESLFESYRESLSVEKY
EDCLCEYVIGSFYVFLIIPGSVQFSARNKSYSIYSDLKKLYQDELNMSNVLLMVLHKVDS
VLNQNMEILAKQHLDPSRKRAFSVEEPIIRYQLHNLQLNNADQKSVDDDYKSFASTEWKA
PQLDPNDRLHLAIASSKTTESSSLNSISLDENLYKEQDDTDALDSVSDKLLGSIHKPDLL
DRTGIIRKVPRHQSLPTEQHHKLYAQNDSSLMLENMDSFDRSRTHRKDSYHSVYLGDELE
DLNNISTGLARHQQENTIDCFALFSLLKDAESRENLLLIDLRLPKRFESNHLVAPNLLNI
DPCLLFDTEKGTSLESFEALKKIVANPILDKISQYDNIVYYTDYKSFMHLTFNYELILFE
LLFKKTGTAIPKSLLGGYEQWKAFLNKQLRDSEFDKSLFLFRKSKSAPSDKTASKPSVQT
DNIIKSSPSILSKEHNDDTLISSTPPIPKVAPPPLPGSPLSAPTIVYNRPPVPLPINSPA
PLLKPSIAKELRTPQRNDWTVQTQHLHVPFSIPTIERSPNEFVSLSITGLRNMGNTCYIN
SMLQCLFGCSQFRDLFLGGKYHRYLNPKRSNTIISKWFSLLFRKMYLNGGCSVVPNGFLK
ACHMLRPDFHIPTDQQDTQEFLLFLLDTLHDELSEPTKVANDYPNLLLHDDEKLLVDNKE
YDKWFDEGLKNNGLSPIDDIFQGQMENSLKCQRCGFTSYNYSTFYVLSLAIPAMPPPKTF
SRSKKIIRLEDCINLYTQDELLTGENAWDCPKCGTHSNSSDGSMNSDETVDKKKKKNFLS
VNGDHKSRSKFFKLSSSRSGKRSLSPFKSNSVKPEKLHIKSKKMTTIKTLNFITMPNILV
IHLSRFFYDLTKKNETMINYPLILDVVLKNNEIARYRLYGIINHFGNLVSGHYTSLVNKH
LSHEIRKGQQKWYYFDDEVVKKEFNHGDFDRGITSISSGDVYVLFYERIHSI
NT seq 3039 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcgactgtacacaccggagtattcggatgaacttctgtcattcgtgcaagaagtg
tatagccaagatgtgaaacattactatgcaaaacttaagttggaaaagcttatagaactt
ttggaacaagctgagtctttatttgagtcatatcgtgaatccttatccgttgagaaatat
gaagattgcttgtgcgaatatgtgattggatccttctatgtctttctaatcattcccgga
tctgtacagtttagtgctagaaacaagtcgtacagcatttactctgatttgaagaaacta
tatcaagatgagttgaacatgtcgaatgttttgttaatggttctgcacaaagttgattct
gtactcaatcagaacatggagatactcgcaaagcaacaccttgacccatccaggaaacgt
gctttctcggtggaagaaccgatcataaggtaccaattacataatttgcagttgaataat
gcggatcaaaaatctgttgacgacgattataaatccttcgcatcaaccgaatggaaagct
ccacaacttgatccaaatgatagattacacctagctattgcgagttcaaaaacaactgag
tcgtcttctttgaactctatctcgctggatgagaacttatataaagaacaagacgatacc
gatgcgttagattcagtttctgataaactattgggttccattcacaaacccgatcttctt
gatcgcacagggataatacggaaagtgccaagacatcaaagccttccgactgaacaacat
cataagctatatgctcagaatgactcttcactaatgttagagaatatggatagttttgat
aggtcacgtacccacagaaaagattcttaccactctgtctatctgggggatgagttagaa
gatctcaacaacatttcgactggattagctcgacaccagcaagaaaataccattgattgt
tttgcccttttttctcttttgaaggatgcagaaagtagagagaatcttttactgattgat
ttgcgacttcctaaaagatttgaatccaatcatcttgtcgctccgaaccttttaaatatt
gacccatgtctcctttttgataccgaaaaaggcacatcattagaatctttcgaagctctt
aaaaagatagttgccaatccaatcttagataaaataagtcaatacgacaacatcgtgtac
tatacggattacaaaagtttcatgcatctcactttcaattacgagttaatactctttgaa
ttactattcaagaagacaggaactgctattccaaaatcattgttaggcgggtacgaacaa
tggaaggcttttttgaataagcagctgcgtgactcagagtttgacaaaagtctcttcttg
ttcagaaagtctaaatcagctccttcggataaaactgcaagcaaaccatctgttcaaact
gacaatatcattaaaagcagtccaagtattctctctaaggaacacaatgatgacacactc
atatcatcaacacctccaattccgaaagtggcaccacctccgctacccggttcaccttta
agcgctcccaccattgtttataatagaccaccagtacctttaccaataaattctcctgcc
ccgctattaaaaccgtctattgccaaagagcttcgtacccctcaaagaaatgattggact
gtacaaactcaacacttacatgttcccttttctattcccactattgaaaggagtcccaat
gagtttgtgtcattatcaataacaggacttaggaacatgggtaatacatgttatatcaac
tcaatgctacagtgtctctttggatgttctcaattcagagatctctttttaggtggaaag
tatcatcgttacttgaacccgaaacgtagcaatactatcatatcgaagtggttcagttta
ctatttagaaagatgtatttgaacggtggatgttcagtggttcctaatgggttccttaag
gcatgtcatatgttgagaccagacttccatattcccaccgatcaacaggatacccaagag
tttctactattcttgctggatactttgcatgatgagttgagcgaaccaactaaggtggct
aatgattatcccaacctcctattgcatgatgacgaaaagcttctggttgataataaggaa
tatgataaatggttcgacgaaggcttgaagaataatggactttcccctatagacgatatt
tttcaaggtcagatggaaaattctttgaagtgtcaacggtgcgggtttacttcttacaat
tactctacgttttacgttttatctttggcaattccagccatgcctccacctaaaactttc
tctagaagtaaaaagataatacggttggaagactgtatcaatctatatacccaagacgaa
ctgttaaccggtgagaatgcctgggactgtccaaaatgtggaacccattcaaattcctcg
gatggatccatgaattctgacgagactgtcgacaagaagaagaagaaaaattttctatct
gttaacggtgatcataaatctcgatctaagtttttcaaattgtcatcatccagatcaggt
aagagatcactatctccctttaaaagtaactccgtaaagccagagaagctacatatcaaa
tctaaaaaaatgacgacgattaagactttgaatttcattactatgcccaatattctggta
attcatttgtctaggtttttttacgatttaaccaagaagaacgagacgatgattaactac
ccattaatattggatgttgttcttaaaaacaatgagattgcaaggtatcgtctatatggt
attattaatcattttggaaatctggtaagcggacattatacatctttagttaacaaacat
ctttcacacgaaattcggaaaggtcagcagaaatggtactactttgacgatgaggttgta
aaaaaagaatttaatcatggtgattttgatagaggcatcaccagtatatccagtggggac
gtatatgtattattctacgaaaggatccatagcatttaa

DBGET integrated database retrieval system