KEGG   Kluyveromyces lactis: KLLA0A03531gHelp
Entry
KLLA0A03531g      CDS       T01025                                 

Definition
hypothetical protein
Orthology
K03253  
translation initiation factor 3 subunit B
Organism
kla  Kluyveromyces lactis
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:kla00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    KLLA0A03531g
Messenger RNA biogenesis [BR:kla03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     KLLA0A03531g
Translation factors [BR:kla03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    KLLA0A03531g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
A:320828..323026
Genome map
AA seq 732 aa AA seqDB search
MTTLESLKIEDIPVDDIDFSDLEREFQIQDGGVNFDNFLVVDGAPVAPEAKVPVLEKVLT
KLFSQAGKVLDMQIPVEDGKTKGHLFIEMESVSAAKEAIQLFNGKKLDAKHRLLVNSLND
MEKYGSDDFESQSHEPVVPDFAPTDFLRSWLQNQDGRDQFVLQKGDMTRVFWNRLAHQPD
GVGEARKNWSNDVVKFSPKGTYLLSFHDQGVTSWGGPNFDRLKRFFHPDVSRLDVSPTEK
FLITFSMNPIKPGEDTPFGPESEGHQICVWDLATGFLMKTFGIPPNAKLQWPLIRFSYDD
KYCGRLGPNALAIYDIENNFQLLDGKLHKVEGIQDFSFAPKGVQLTYNRRKSDPTTLLAY
WTPETNNQSCKAFLMTLPNKRIVKTVNLVQVSNVSIHWHEQADFVCFQVDRHTKSKKTFF
TNLEICKLNESEIPVEKIEMKDRVLELAWEPKGTRFVTISKMDNGGEENPMYPKNFVKFF
APEKKDNKDKDLAVLPDQLKWKLVKTVDQQFANCISWSPAGRFVAVCTIVNGKEIKKASL
DFYDFDFTGEKTLNEVQDVKASLQAVAHIDNQFFTDLEWDSSGRFLTAWSSYSKHKLENG
YTIYNCCGEAVRKEIVDQFRNFVWRPRPESLLSNAEKKKARKNLKQWSVKFEEQDAMESD
SALRDLILKRRAELSAWVSYREQSKERLESEDSYTIFDNFESDKADETQYVTVEEVKEEI
LEETQEEVESFE
NT seq 2199 nt NT seq  +upstreamnt  +downstreamnt
atgaccactttagagtccttaaagatagaagatattccggttgatgacatcgacttttcc
gatttggaaagagaattccaaatccaggatggtggtgtgaactttgacaactttttggtt
gtcgatggcgctccagttgcaccagaagctaaagttccggtcttagagaaggttttgacc
aagttgttcagtcaagccggtaaagttctggatatgcaaattccagttgaagatggtaaa
accaagggtcatttgtttattgaaatggaatctgtttcagctgctaaagaagctatccag
ttattcaacggtaaaaagttagatgccaagcatagattgcttgtcaacagtttaaatgat
atggaaaagtatggttctgacgatttcgaatcacaatctcacgaacctgttgttccagac
tttgcgccaacagatttcttgagatcttggttgcaaaaccaagacggtagagaccagttt
gttctacaaaagggtgacatgacccgcgtattctggaacagattggctcatcaacctgat
ggtgtcggtgaagccagaaagaactggtcaaacgatgtcgtgaagttctcaccaaagggt
acttatctattatctttccatgaccaaggtgttacttcttggggtggtccaaacttcgac
agattgaagagatttttccatccagacgtttcccgtctagatgtttctccaactgagaag
tttttgatcactttctcaatgaatccaattaaaccaggtgaagacactccatttggtcct
gaatctgaaggtcatcaaatttgtgtttgggatcttgctactggtttcctaatgaaaacg
ttcggtattccaccaaatgccaagttgcaatggccattaattagattctcttacgatgac
aaatactgtggtcgtctaggtccaaacgctttggctatttacgatattgaaaacaacttc
caattgttggatggcaaacttcacaaggtcgaaggtattcaagatttctctttcgctcca
aagggtgtacaattgacatacaacagaagaaagagtgacccaactacattattggcatac
tggactccagaaactaataaccagtcatgtaaggctttcctaatgactttaccaaacaag
agaatagtcaaaactgtcaatttggttcaagtttctaacgtttctattcactggcatgaa
caagcagactttgtctgcttccaagttgatcgtcataccaagtccaagaagactttcttc
accaatttggaaatttgtaagttaaatgaatccgaaattcctgtcgagaaaatcgaaatg
aaggaccgtgtgttggagttagcatgggaaccaaagggtactagatttgtcactatttcc
aagatggataatggtggtgaagaaaacccaatgtatccaaagaactttgtcaaattcttt
gctccagaaaagaaggataataaagataaggatctagccgtcttacctgatcaattgaaa
tggaaactagtaaagactgttgatcaacaatttgccaattgcatctcttggtccccagct
ggccgttttgtcgcagtgtgtactatcgttaatggtaaggaaatcaagaaagcatctctt
gacttctacgactttgatttcactggtgaaaagactttgaatgaagtccaggatgtcaaa
gcatctttgcaagcagttgctcatatcgataatcaattcttcactgatttagaatgggat
tcttccggtagattcttaacagcttggtctagttacagcaagcacaagctagaaaatggt
tacactatctacaactgctgcggtgaagctgttcgtaaggagatcgtagatcaattcaga
aacttcgtctggagaccaagaccagaatcactcttgtctaacgctgaaaagaagaaggca
agaaagaatctgaaacaatggtctgtcaagttcgaagaacaggatgccatggaaagtgac
agtgctttgagagatttgatcttgaagcgtcgtgcggaattgagcgcatgggtctcttac
agagagcaatccaaggaaagattggaatccgaagacagttacactattttcgacaacttc
gaaagcgacaaagctgacgaaactcaatatgtcactgtggaagaagttaaggaggaaatc
ttagaggaaactcaagaagaggtcgaatcgtttgaataa

DBGET integrated database retrieval system