KEGG   Kluyveromyces lactis: KLLA0A05819gHelp
Entry
KLLA0A05819g      CDS       T01025                                 

Definition
hypothetical protein
Orthology
K18670  
dual specificity protein kinase YAK1 [EC:2.7.12.1]
Organism
kla  Kluyveromyces lactis
Brite
Enzymes [BR:kla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     KLLA0A05819g
Protein kinases [BR:kla01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   KLLA0A05819g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
A:541545..543659
Genome map
AA seq 704 aa AA seqDB search
MGDKNSLWNPAFMASQQGASSSNQNQNFSQTQANTQNQGPEIAPDGPAGSSSNAGGNIYA
GQQQGGNAAGGFQMQSPRQSIFKNPWQEIPQIPESQRSTMRKQSNFPLPTTYEEDNAVDE
SSQQFRRRNSSLVIPPARAAGPDPFLYEKQPFPNYNDAQRRQSVAVTGGSQLSPQQVTKP
SQLRKPGINTAGYMAGSINSSVYPATAGAYMSTRGGSSSLPSSRPPSPIIIVPKFNKIFT
RQDLNPVIHSTPKYRRASLSSKTVSPLMALTKSLTTTYSLCNDDFAYQTSKNPKRVLTKP
NEGKYNNGHDNVNSDYILYVNDVLGVEHNRKYLVLDLLGQGTFGQVVKCQNLITKEILAV
KVVKSKSEYLNQSVTEAKVLELLNRQIDPNNEHHFLRLHDTFVHKHHLCLVFELLSNNLY
ELLKLNEFHGLSMTLIKTFSKQLLDSLCVLKDSKLIHCDLKPENILLVSNDRPDLKVIDF
GSACEETRTIYTYIQSRFYRAPEVLLGIPYSTGIDMWSFGCIVAELFLGIPIFPGNSEFD
QVTRIVESLGMPPAWMCDMGKNSKKYFHKMNTTVEKKFRMKTIDEFNLEFAANEESVKRY
VKHILFDDIIRNARISKRISGNPALVEREIKNRDCLLHFLRGVLNLNPLERWTPQQAILH
PFITEEPFTGEWYPPGTIPKKSQTARNPSLQFDSVALDKLQLGD
NT seq 2115 nt NT seq  +upstreamnt  +downstreamnt
atgggggataagaatagcctttggaaccctgcgttcatggcttctcagcagggagcgtcg
agttcgaatcagaaccagaacttttctcagacgcaggcaaatacccagaatcagggccca
gagattgcgcctgatgggccagctgggagtagctccaatgcaggcgggaatatatatgca
gggcagcaacaaggcggaaatgcggctggtggtttccaaatgcagtcgccacgtcaatcg
atattcaaaaacccatggcaagagattccccagatacctgagtctcagaggtctactatg
aggaagcaatccaacttccccttgcccactacttacgaagaagataacgctgtagatgaa
tcctcacaacagttcagaaggagaaactcatctttagtaataccacctgcgcgtgcggca
gggcctgatccgttcctttatgagaagcaaccgtttcccaactataatgatgcacaaaga
aggcagtcggttgctgtcactggtggcagtcaactttcgccacagcaggtaacgaaacca
tctcagcttaggaaacctggaattaatactgcgggatatatggctggctccataaattct
tctgtgtatcccgctactgcaggtgcatacatgagcacgcgtggcggctcaagttcactt
ccgtcgtcaaggccaccttctccaataattattgtccctaaattcaacaagatatttacg
agacaggacttgaatcccgttatacattccacaccgaaatatagacgtgcttcattaagc
agcaagacggtctcgccgttgatggctctaactaagtcgttaactaccacttattcattg
tgtaatgacgattttgcatatcagacatcaaagaacccgaaaagagtgctaacaaaacca
aatgaggggaaatataacaatggacatgataatgtcaacagtgactacatcctttacgtt
aatgatgtgttgggggttgaacacaacagaaaatatttggtcttggaccttttgggtcaa
ggaacttttggtcaagttgtgaaatgtcaaaacttaataacaaaagagattctagcagtg
aaagttgtgaaatctaaatcagaatatttgaatcagtcagtcactgaggctaaagttttg
gaattattgaacagacaaattgatcctaataatgaacatcacttcttaaggttgcatgac
acgtttgtgcataagcatcatttgtgtcttgttttcgaattgttgagtaacaatttatat
gaattgttgaagttgaatgaattccatgggttgagcatgacacttattaaaacattttca
aagcaattattggattcactatgtgtcttgaaggacagtaagttgatccattgtgatttg
aaaccggagaatatattgttggtaagcaacgatcgacctgatttaaaagtcattgatttt
ggatctgcatgtgaggaaacacgtaccatttacacatacattcaatcaagattctataga
gctccagaagttcttttggggattccttattctaccgggatagatatgtggtcctttggt
tgtatcgttgcagaattgtttcttggtatacctatctttcccggtaattctgagtttgat
caagttacaagaatcgtggaatctttggggatgccacctgcatggatgtgtgatatgggt
aaaaactctaagaaatatttccataagatgaataccactgttgagaaaaaatttagaatg
aaaaccattgatgagtttaacttggagtttgctgctaacgaagagtcagtgaagagatac
gtgaaacatatattgttcgatgatataattcgtaacgcaagaatttcgaaaaggatttct
gggaatccagcacttgttgaaagagaaataaagaacagggactgcttgttacattttttg
agaggagtgttgaacctcaatccactcgaacgttggaccccacaacaggccattttgcat
cccttcatcacagaagaacctttcacaggggagtggtacccaccgggtaccattccaaag
aaatcacaaacagctcgtaatccttcattacaattcgactctgtagcgttggacaagtta
caacttggcgactaa

DBGET integrated database retrieval system