KEGG   Kluyveromyces lactis: KLLA0A08492gHelp
Entry
KLLA0A08492g      CDS       T01025                                 

Definition
hypothetical protein
Orthology
K00273  
D-amino-acid oxidase [EC:1.4.3.3]
Organism
kla  Kluyveromyces lactis
Pathway
Glycine, serine and threonine metabolism
Arginine and proline metabolism
D-Arginine and D-ornithine metabolism
Metabolic pathways
Peroxisome
Brite
KEGG Orthology (KO) [BR:kla00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    KLLA0A08492g
   00330 Arginine and proline metabolism
    KLLA0A08492g
  Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    KLLA0A08492g
  Biosynthesis of other secondary metabolites
   00311 Penicillin and cephalosporin biosynthesis
    KLLA0A08492g
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    KLLA0A08492g
Enzymes [BR:kla01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.3  D-amino-acid oxidase
     KLLA0A08492g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
A:751047..752168
Genome map
AA seq 373 aa AA seqDB search
MAKVVVVGAGISGLSVAHSLLELYGRDKIEELVIIARDIPGTFTSYDYTSPWAGANWDSF
AAPDDHAQIKRDTVTYEWFTELARSKPETGVKEYTLKLVTRKETIPWFVRDNFVRDLKQM
SEEELKYRNLDPQDYHGFEFTTFTVTPSTYKFWMVNEIKKMGGKLRQLAKIDAIENIPEI
VGFVPDLVINATGVHAGQFLRHYEPSEVEKVYPVKGQIVQIYEDLPFQIVVEPLPKDDNP
ASDQFLNMFPRGDGGCIIGGIMRKNDWSNTVDDELTKKIVEVCKRHTPELKNPTIYNSYV
ALRPGRKDGVRVEYSEFDLPKNQGKLKVIHNYGIGGAGYQASRGLALEASALAAANVLGL
PKFISRKACPYKL
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atggctaaagttgtggttgtcggtgcaggtatctctggtttgagtgtcgcacactcttta
ttggaattatatggtcgtgataagattgaagaattagttatcatcgctcgtgatatccca
ggtacttttacatcgtacgattacacttcaccttgggcaggtgccaattgggattctttc
gcagcaccagatgatcatgctcagattaaaagagatacggtgacttatgagtggttcact
gaattggctagatccaaaccggagactggggtgaaagagtacacattgaagctggtgaca
agaaaggagaccataccatggtttgttagagataattttgtcagagatttgaagcaaatg
tctgaagaagaattaaagtacagaaatttggatccgcaagactaccatggattcgaattc
actactttcactgttactccatctacttataagttctggatggtcaatgagattaagaaa
atgggtggtaaactcagacaactggcaaagattgatgccattgagaatattcctgaaatc
gttggatttgtgccagatttggtaatcaatgctacgggtgttcatgcaggtcaattcttg
aggcattatgaaccctcagaggttgaaaaggtgtacccagtgaagggtcaaatcgttcag
atttatgaggatttacctttccaaattgttgtggaaccgttgccaaaggatgataatcct
gcaagcgatcaattcttgaacatgttccctcgtggtgacggtggttgtattatcggtggt
attatgaggaaaaacgattggtcaaataccgttgacgatgaattgacaaagaaaatcgtt
gaagtttgtaaacgccatacaccagagttgaaaaatccaaccatctataactcttatgtg
gcattgagaccaggaagaaaagatggtgtcagagttgaatactctgagttcgatttacca
aaaaatcaagggaaactcaaggtgatccataactacgggattgggggagctggttaccaa
gcatcccgtggtcttgccttggaggcttccgctttagctgctgctaatgtgttaggtcta
cctaagtttatctcaagaaaagcttgtccatacaaattatga

DBGET integrated database retrieval system