KEGG   Kluyveromyces lactis: KLLA0A09471gHelp
Entry
KLLA0A09471g      CDS       T01025                                 

Definition
hypothetical protein
Orthology
K07204  
regulatory associated protein of mTOR
Organism
kla  Kluyveromyces lactis
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
A:complement(827264..831784)
Genome map
AA seq 1506 aa AA seqDB search
MVVYGPQPLTRLNTETRHGFEEQYSSEKLLEAHASNFIFYYDDKRHRTNGNPVPEEVKQE
DKDGYYQPIPDWKIVKDRQKTVAAALLLCLNLGVDPPDVTKTQPCARLESWVDPLAFQDS
KKAIEQIGKNLQSQYETLSLRTRYKQSLDPCVEDVKRFCNSLRRASKDERILFHYNGHGV
PQPTPSGEIWVFNRGYTQYIPVSLYDLQTWLGAPCIYVWDCNSAGNIVSNFKKFVQKRLR
DDREGNHDMASPSPTEAYTECVQLASCANNELLPMNPELPADFFTCCLTNPIEISVKVFL
MQSPLKDTKYSVFFQDNDPRRKETGVNEMPNITIPGKLSERRTPLGELNWIFTAITDTIA
WTSLPRALFKKLFRHDLMVAALFRNFLLAKRIMPWYNCHPVSDPELPDSIADHPMWRSWD
LAIDEVLTKLLESAHANAKNSNFPESQFISQPNEGNETNDGLQSKNTIGNLSSMSLVNFS
STAHTSSGNSASHPTTSQQQQQQFTKFFEQNLTAFDLWVKYGANSRHPPEQLPIVLQVLL
SQVHRVRTLVLLSRFLDLGPWAVYLSLSIGIFPYVSKLLQSPAHELKPILVFIWARIFSI
DYKNTQTELIKERGYQYFVKMLVPEFGVPRGHSVSSAGSPLTMNVPASSSTQRYQMYQQQ
QQQQAYNNATLLSNNNTTDEQKAMAAFVLSCFVRDFPLGQKHCFSTELVNKLCFFIENSE
VPLLRQWCIILLGQLYIHNPLHKTLCLENENMNTIIESLKDPIPEIRCAALLAIKYFLSE
EDDVNIILKLQQEFQQQLQQFQAQLQLLQSQQNQQQQQQQGNQQNSTHHIQQQYYQIQQQ
SQQVQTSMSQLQSINLRNLKQFEIKTIITTLSLVNDGSPMVRKELIIFLSQVVERYIEFF
TVIAFTEISTEIVALETNGHEDDSRNPTSVGHGSIFNTVWKALLISSEDPFVENRELAGD
VVDYILIKLNEHSKLAEMVKEMEQYILKRSVVNVKGFTSPNKLPAIRRPASLSNGKHDHY
RNDTVSDRRVFSMNSILKALGFANDQDSYSDHESTSSGNGKMAQGLSLMGIEYGTSPRAF
PAMYRKRDTPLTLPLESCFLNYCSEYFQEPQMKKQEADEPGSIEFTAREWKRNRNEAIIQ
ETQSQKELALYGDWSHKIVTFDNKTQPKILLFTQFDNYIAASDDRDNITIYDWSTQEKLS
RFSNGNPFGTKITDMKFLNDDDTPLLLAGSSDGIVNIYKDFHDTEDLFMISSWRGLTDLL
LTPRSTGLLTEWQQSRGSLLVTGDVKIIRIWDALTESVEVDIPAKSSSLITSLTSDQFSG
NIFVAGYSDGSIRVYDRRMDPRDSMIRLWKTPKSDNSPVGSWVNNIHLQRGGYRELVSGT
NNGVVALWDIRADKPVCTFTDEGEPGKKLGSTMTSMQVHEHASIIATGTKEIKLWTTSGD
LLRTFKNHGSSHSGPISGMTTGARSSPFISTMAFHPHRMMLTANNSHDTTFNIYECLDNR
RDYMYY
NT seq 4521 nt NT seq  +upstreamnt  +downstreamnt
atggttgtttacggcccacagcctttgacacggcttaatactgagactagacatgggttt
gaagagcagtattcaagtgagaaactcttggaggcgcatgctagcaattttatattttat
tacgatgataagaggcatcgaaccaatgggaatccagttcctgaggaagtgaagcaagag
gataaggatggatattaccagccaattcctgattggaaaatagttaaggacaggcagaag
acagttgcagcagcattattactatgtttgaatttgggagtggatcctcctgatgtgact
aagactcagccatgtgcaagacttgaatcatgggttgatccccttgcatttcaggattct
aagaaagctattgaacaaataggaaagaacttacagagtcaatacgagacgctatcacta
cgtactcgttataaacagagcttagatccctgtgtggaagatgtgaaacgcttctgtaat
tcattgagaagggcttcgaaagacgaaagaattctgttccattataacggtcatggtgta
ccacaaccaacaccatctggagaaatctgggttttcaaccgtggatatactcagtatatc
ccggtttcattatatgatttacaaacttggctaggagccccttgtatatatgtctgggat
tgcaatagtgctggtaacattgtatccaactttaaaaagtttgttcaaaagagattgaga
gacgatagagaaggcaatcatgatatggcatcaccttcacctacagaagcatacactgaa
tgtgtgcaattagcgtcatgtgcaaacaacgaattattgcccatgaaccctgaattaccc
gcagattttttcacctgttgtctaacgaatccaatagaaatatctgttaaggtgtttcta
atgcaatctcctttgaaagacaccaaatattccgtgttcttccaagataacgatcctaga
agaaaagagacgggtgtgaatgaaatgcctaacattacgataccggggaaattgtctgag
cgtaggactccccttggtgaattgaattggatatttactgctattacagataccattgca
tggacatcattaccaagagcactatttaagaagctattcagacatgacctcatggtcgcg
gcattatttcgtaactttttactcgccaaaagaataatgccttggtacaattgtcatcca
gtatcagacccagagttaccagactcaattgctgatcatccaatgtggagatcgtgggat
ctagcaatcgacgaagtattgaccaaacttctggaaagtgctcatgctaatgcaaagaat
tcaaacttccctgaatcacagtttataagccaaccaaacgaaggcaatgaaaccaatgac
gggctgcaatcgaaaaatactattggaaacctgagctccatgtcattggtaaactttagt
tcaacagcacatacctccagcggtaattcagcctcgcacccgactacctctcaacaacaa
cagcaacaatttacgaaattttttgagcaaaatttaaccgcatttgatttatgggtgaaa
tatggggctaattcaagacatccacctgagcagctccccatagtactacaggttctctta
tcacaagtccatcgtgttaggactttggtactgctatctagatttcttgatcttggacca
tgggctgtatacctatcactttcaattgggatattcccttatgtttccaaactgctacaa
agtcctgcccatgagttgaaaccaattctagtgttcatttgggctagaattttttctatt
gactataaaaatacccaaacagaacttataaaggagcgtggataccaatactttgtaaag
atgcttgtacctgagtttggtgtcccaagaggacatagtgtcagtagtgctggaagtccc
ttgactatgaatgtacctgcaagttcttcaacacagaggtaccagatgtatcaacagcag
cagcagcagcaagcatataataacgcgacgttattatctaacaataatactacagatgaa
caaaaggcaatggcagcatttgtcctatcgtgctttgttcgcgatttcccccttggtcaa
aaacactgtttcagcactgaattagtaaacaagttatgcttctttatcgaaaattctgaa
gttccgttattaagacagtggtgtatcattttacttggtcagttatacattcacaatcca
ttgcataagacattatgcctcgaaaatgaaaatatgaatacaatcatagagtctttaaaa
gatccaattccagagatcagatgtgctgcgttattagcaatcaagtacttcctttctgaa
gaagacgatgttaacattatcttgaaactccaacaagaatttcagcaacaattacaacaa
ttccaagcgcagctgcagcttttgcaatctcaacaaaaccagcagcagcagcagcaacag
ggaaatcaacagaatagtacgcatcacatacagcaacaatactatcaaattcagcaacaa
tcccaacaagtccaaacatcaatgagtcaattgcaaagtattaatttacgcaacctcaaa
caatttgagattaagaccattatcacaaccctttcgctagtcaacgatggtagtccaatg
gtacggaaggaattgatcatctttttatctcaagttgtagaaaggtatatcgaatttttc
actgtaattgctttcactgaaatcagcacagaaatagttgcgctagaaacgaatggccat
gaagacgactcaagaaatcctacttcagttggtcatggttccatattcaataccgtgtgg
aaagcgttattaatttcttctgaagacccatttgtcgaaaatagagaacttgcaggagat
gtagtagattacatcctcattaagctaaatgaacacagtaagttggctgaaatggtgaaa
gaaatggaacaatacattttgaagagaagcgttgttaacgtcaaaggtttcacctcccca
aataaattaccagcaataagaagaccagcaagtttgagtaatggtaaacatgaccattac
cgaaacgatactgtcagtgacaggcgtgtattctctatgaattcaattctgaaggcactt
ggatttgctaatgaccaagattcatactccgatcatgagagcactagtagtgggaatgga
aaaatggcacaaggtctttctttaatggggatcgaatatgggacaagtcctagggctttc
cccgcaatgtataggaagagagatacacccttgactttaccgttggaaagctgtttcctc
aactattgtagtgaatacttccaagaaccacaaatgaaaaaacaggaggcagatgaacct
ggtagcattgaatttaccgctcgtgaatggaaaagaaacagaaatgaggcaatcatccaa
gaaactcagtcacagaaagaactggcactatatggtgactggtcacacaagatagtgact
tttgacaacaagacgcaaccaaagatactcttattcactcaatttgacaattatattgcg
gcaagtgacgatagagacaatattaccatatatgattggtctactcaagaaaaattatct
cgattctctaatggcaatccattcggtacgaaaatcaccgacatgaagtttttaaatgac
gacgacacaccgttgttattggcaggctcttcagacggtattgtaaatatctacaaagat
ttccatgacactgaagatctatttatgatttcttcttggagaggattaacagatttgcta
ttgactcctaggtctacaggcctattaactgaatggcaacagagcagaggttcattacta
gtcactggtgatgtgaaaataattcgtatctgggatgcgcttacggagtctgtggaagtg
gatataccggcgaaatcaagctctttaatcacatctttaacttctgaccagttttctgga
aacatttttgttgcaggttactccgatggctctattcgggtgtatgacagacgtatggat
cccagagattcaatgatcaggctttggaaaacgccaaaaagtgataacagtcctgttggg
tcatgggtgaacaatatccaccttcaaagaggtggttaccgtgaactagtcagcggcaca
aacaatggggttgttgccctatgggacatcagagctgataaacctgtttgcacgttcact
gatgaaggtgaaccagggaagaagctaggcagtaccatgacaagtatgcaagtacacgaa
cacgcttcaattatagcaactgggacgaaagaaatcaaattatggacaacatctggagat
ttgttacgcacctttaagaatcacggttcctctcattcaggaccaattagtgggatgact
actggtgcaagatcatcgcctttcatttccactatggcattccatccacaccggatgatg
ttaacggcaaataattctcatgatacaacattcaatatttatgaatgccttgataataga
agagactatatgtactactag

DBGET integrated database retrieval system