KEGG   Kluyveromyces lactis: KLLA0A10417gHelp
Entry
KLLA0A10417g      CDS       T01025                                 

Definition
(RefSeq) hypothetical protein
  KO
K01193  
beta-fructofuranosidase [EC:3.2.1.26]
Organism
kla  Kluyveromyces lactis
Pathway
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kla00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    KLLA0A10417g
   00500 Starch and sucrose metabolism
    KLLA0A10417g
Enzymes [BR:kla01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     KLLA0A10417g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
A:complement(910347..912176)
Genome map
AA seq 609 aa AA seqDB search
MLKLLSLMVPLASAAVIHRRDANISAIASEWNSTSNSSSSLSLNRPAVHYSPEEGWMNDP
NGLWYDAKEEDWHIYYQYYPDAPHWGLPLTWGHAVSKDLTVWDEQGVAFGPEFETAGAFS
GSMVIDYNNTSGFFNSSTDPRQRVVAIWTLDYSGSETQQLSYSHDGGYTFTEYSDNPVLD
IDSDAFRDPKVFWYQGEDSESEGNWVMTVAEADRFSVLIYSSPDLKNWTLESNFSREGYL
GYNYECPGLVKVPYVKNTTYASAPGSNITSSGPLHPNSTVSFSNSSSIAWNASSVPLNIT
LSNSTLVDETSQLEEVGYAWVMIVSFNPGSILGGSGTEYFIGDFNGTHFEPLDKQTRFLD
LGKDYYALQTFFNTPNEVDVLGIAWASNWQYANQVPTDPWRSSMSLVRNFTITEYNINSN
TTALVLNSQPVLDFTSLRKNGTSYTLENLTLNSSSHEVLEFEDPTGVFEFSLEYSVNFTG
IHNWVFTDLSLYFQGDKDSDEYLRLGYEANSKQFFLDRGHSNIPFVQENPFFTQRLSVSN
PPSSNSSTFDVYGIVDRNIIELYFNNGTVTSTNTFFFSTGNNIGSIIVKSGVDDVYEIES
LKVNQFYVD
NT seq 1830 nt NT seq  +upstreamnt  +downstreamnt
atgttaaagttgttgtcattaatggtgcctttggcatctgctgctgtcatccaccgccgt
gatgctaatattagtgccattgctagcgaatggaattctacttctaattcgtcctcttct
ctcagtttgaacagacctgctgtccattattccccagaagaaggttggatgaacgatccc
aatgggttgtggtatgatgctaaggaagaagattggcatatatactatcagtactatcca
gacgcaccacattggggtttaccattgacttggggtcatgctgtctccaaggatttgacc
gtttgggatgagcaaggtgttgcatttggaccagaattcgaaactgctggtgccttctct
ggtagtatggtcattgattacaacaacacttccgggttcttcaacagctctacggatcca
agacaaagagtggttgctatttggactttggactacagcggcagtgagactcaacaattg
agttattcccatgatggtggttacacgtttactgaatactctgacaacccagtgttggat
atcgattctgatgccttcagagaccctaaggtgttctggtaccaaggtgaagattctgaa
tccgagggtaattgggttatgacagtcgccgaagctgaccgtttctctgtcttgatttac
tcttctccagatttgaagaactggaccctagaatctaacttctctcgtgaagggtacttg
ggttacaattacgaatgtccaggtcttgttaaggttccatacgttaagaataccacttat
gccagtgctccaggttctaacattacttcttccggtccattacatccaaacagcaccgta
tcattctccaactcctcttctatagcatggaatgcctcttctgtcccattgaacattact
ttgtcaaattctacattagttgacgaaacttctcaattggaagaagtcgggtacgcatgg
gtcatgattgtttcctttaaccctggctctatcttgggtggttctggtactgaatacttc
atcggtgacttcaacggtactcacttcgaaccactcgacaagcaaactagattccttgac
ttgggtaaagattattatgctctacaaaccttcttcaatactccaaatgaagtagacgtc
ttgggtattgcttgggcttctaattggcaatacgctaaccaagtacctaccgacccatgg
cgttcatctatgagtttggtcaggaacttcaccattactgaatacaatattaattcaaac
acaactgcgttggtattgaacagtcaacctgtgcttgacttcactagtctgagaaagaac
ggtacttcatacacccttgaaaacttgacgttgaactcttcatctcacgaagtgcttgag
tttgaagaccctaccggtgtattcgaattctctcttgagtattccgtcaatttcactgga
atccataactgggtcttcaccgatttatccttatacttccaaggtgacaaggacagcgac
gaatacttgagattaggctacgaagctaattccaagcaattcttcttggaccgtggtcat
tccaacatcccattcgttcaagagaacccattcttcactcaaagactctcagttagcaat
ccaccttctagtaattctagcaccttcgatgtttatggtatcgttgacagaaacattatc
gaactttacttcaataacggtactgtcacttccactaacactttcttcttctccacaggt
aacaacatcggctccattattgtgaagtcaggtgttgacgatgtttatgaaatcgagagt
ttgaaggtgaaccaattctacgttgattga

DBGET integrated database retrieval system