KEGG   Kluyveromyces lactis: KLLA0A10791gHelp
Entry
KLLA0A10791g      CDS       T01025                                 

Definition
hypothetical protein
Orthology
K11843  
ubiquitin carboxyl-terminal hydrolase 14 [EC:3.1.2.15]
Organism
kla  Kluyveromyces lactis
Brite
Enzymes [BR:kla01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     KLLA0A10791g
Peptidases [BR:kla01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   KLLA0A10791g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
A:complement(join(934135..935573,935718..935733))
Genome map
AA seq 484 aa AA seqDB search
MSDLEFNIKHAGKVYPITINADAKAADLRAKVEALTLVPQERQKYMVKGGLTDNETLVSS
VIKAKATVMVLGTPDANLVFKPTDDTKFLEDLTDKERLMQEDTIPMGLRNMGNTCYFNAS
LQALYRIKPLREKVLAYNEPNPDLHGQLVIQLRNCFNAFAQRKEKEFTPIILLTVLRKIY
PQFAEKDPSTGFYKQQDAEELFTQLLHTIDTVFGESLSSKFEIEFQTTVKDTLNETDVQT
KIESDKKLQCHISGTTNFLKNGLTESLVEKVEKRSEATGSNSIFENSKKITKLPEYLTVQ
FVRFYWKRSTGKKSKILRKVQFPFQLDVADLLTPEYATAKIKVRDELREVDKQREDDLKE
FNQNILEHVPLSLTPAERYETQMALEESKREHWLAEFAKKFPKDLRQGENPSSVYNLIGV
VTHQGANSDSGHYQAFVRDDADENKWYKYNDDKVYVVTREKVEQLAGGGESDSALILIYK
GFGL
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatttagaattcaatattaaacatgcaggaaaagtttacccaatcacaataaat
gccgatgctaaggcagcagacctaagagctaaagttgaagctctgactcttgttccacaa
gaaagacaaaaatacatggttaagggaggtttaacggataacgaaacgttagtttcatct
gtcatcaaagctaaggctacagtaatggttcttggaacccctgatgctaatttagtcttt
aaaccaacggatgatacgaaatttttggaggatttaactgacaaggaaagattgatgcaa
gaggataccattccaatggggttaagaaatatgggtaatacatgttatttcaatgcatct
ttgcaagctctatacaggattaaacctttgagagagaaggtattggcctataacgagcca
aatcctgatctacacggacagttagtcatacagctgagaaattgtttcaatgcatttgct
caaaggaaagagaaggagttcaccccaattattctactcacagtcttgagaaagatttac
ccgcaattcgctgagaaggacccaagcactgggttttacaagcaacaggatgcggaagag
ttgttcacacagttgcttcacactattgacactgtgtttggtgaatccttgtcatctaag
ttcgagatcgaattccaaactacagttaaggatactctgaacgaaacagacgtacaaacc
aagatagaatcagataaaaaattgcaatgccatatttcaggtactaccaatttcctaaaa
aatggtcttactgaatccttagtcgagaaagtggagaaaagatctgaagctactggttct
aactcgatctttgagaattctaagaagattaccaaattaccggaatatttgacagttcag
tttgttagattttattggaaaagatcgactggtaagaagtccaagattttgcgtaaggtt
caattcccattccagcttgatgtagcggatcttttaaccccagaatatgcaaccgcaaag
attaaagtcagagatgaattgcgtgaggtagacaagcagagagaagatgatttaaaggaa
ttcaaccaaaacattctcgaacatgtgccactatctttgactccagctgaaaggtacgag
acacaaatggctcttgaagaaagcaaaagagagcattggttagcagaatttgcgaaaaaa
ttccctaaagatctaagacaaggtgaaaatccatcttctgtatacaatttgatcggtgtc
gttacacatcaaggtgctaattccgacagtggacattaccaggcctttgtcagggatgac
gcggacgagaataaatggtacaaatataatgatgacaaagtatacgttgttacaagggaa
aaggttgagcaattggctggtggtggtgaaagtgacagtgctttaattcttatctacaaa
gggtttgggttatga

DBGET integrated database retrieval system