KEGG   Kluyveromyces lactis: KLLA0A11176gHelp
Entry
KLLA0A11176g      CDS       T01025                                 

Definition
hypothetical protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
kla  Kluyveromyces lactis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:kla00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    KLLA0A11176g
Enzymes [BR:kla01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     KLLA0A11176g
Exosome [BR:kla04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   KLLA0A11176g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
A:complement(970974..973133)
Genome map
AA seq 719 aa AA seqDB search
MTGDNNDIPENVRGVVEIDSWLTPFAKVLSERRYLADEWRYKIEHSTNSEGRDTTLAQFA
RDAYKSFGLHADPGSLEIRYKEWAPNAVRAFLIGEFNSWNENANEMQRDEYGIFTTVVPP
VVDDSGNKQYGIPHDSKVKVCFQLADGSRIYRLPAWITRATQPDKETAKQWGPSYEARFW
NPPVHYSFKNKRPGFMRDTDSLRIYEAHVGISTPEPKVGSYKEFTQNVLPRIKDLGYDAI
QLMAIMEHAYYASFGYQVTNFFAASSRFGTPDELKELVDTAHGMGILVLLDVVHSHASKN
VTDGLNQFDGSDHQYFHSLASSRGEHPLWDSRLFNYGHFEVQRFLLANLAFYIDVYQFDG
FRFDGVTSMLYLHHGVGEGGAFSGDYNEYLSSERSFVDHEALAYLMLANDLVRELLPDNG
ITIAEDVSGYPTLCMPRHLGGAGFDYRLAMALPDMWIKLLKESRDEDWEMGHIVHTLVNR
RHREKVVAYTESHDQALVGDKTLAFWLMDAAMYTDMTILKESTPVVDRGIALHKLIRLIT
HSLGGEAYLNFEGNEFGHPEWLDFPNVNNGDSYHYARRQFNLVDDPLLRYQYLYQFDKAM
QTTEKNYKWLNTPQAYVSLKHEVDKVIAFERNGLLFIFNFHPTESFTDYRIGVNEPGCYR
IVLNSDKHEYGGWDRIDESQSKYFTTDLKWNERNNFIQVYIPNRTALVLALDSRVRNGN
NT seq 2160 nt NT seq  +upstreamnt  +downstreamnt
atgactggtgataataacgatattcctgagaatgtcagaggcgttgttgaaattgactct
tggttaactccttttgctaaggttctctctgagagaaggtacttggcagatgagtggaga
tataagattgaacacagtacgaattcagaaggcagagataccactttggctcaatttgct
cgtgatgcttataagagttttgggttgcatgcagatcctggtagtcttgagattcgttat
aaagaatgggctcccaacgccgtgcgagcctttttaataggtgaattcaactcatggaat
gaaaatgctaatgaaatgcaaagagatgagtatggcatttttaccactgttgtgccacct
gtcgttgatgatagtgggaataaacaatatggaattccacatgattctaaggtgaaggta
tgcttccagttagctgatggttctaggatctatagattgccagcatggattacaagggct
acgcaaccagataaagaaaccgcgaagcagtggggcccctcctatgaggccaggttctgg
aatcctccagttcactactcttttaaaaacaagagaccaggattcatgagagacactgat
tcgttgcgtatctacgaggcgcacgtaggtatctctactccagaacctaaagttggttct
tataaggagtttacccaaaacgttttacctcgtattaaggatttagggtacgatgccatt
caattaatggctattatggaacacgcatactatgcttctttcggttaccaggtgaccaat
ttctttgccgcttcttcccgttttggtacgcctgacgagttgaaagagttggtcgatact
gctcatggaatgggaattctagtgctcttggatgtggttcattctcatgcttctaaaaat
gttactgatggcctaaaccaattcgacggatccgatcatcaatatttccattctttggca
tcttctcgtggtgaacatcctttatgggattctaggctatttaactatgggcattttgaa
gtacaaagattcctacttgctaatctagcattttacattgatgtgtatcaatttgacggg
ttcagattcgatggtgtaacatcaatgctatacttgcatcatggtgttggtgaaggtggt
gccttcagtggtgattacaatgagtacttatctagtgaaagatcttttgttgatcatgag
gccttggcatacttgatgttagctaatgaccttgtcagagaattgttaccagacaacgga
atcaccattgcagaagacgtttcagggtatccgactctttgtatgccacgtcatctggga
ggcgctggttttgattaccgtctagcaatggcgttacctgatatgtggatcaaacttttg
aaagaaagcagagacgaggactgggaaatgggtcatattgttcacaccttggtaaataga
aggcaccgtgaaaaggttgtcgcatatacggaatctcatgatcaggctttggttggtgat
aagaccttggcattctggttgatggatgcggccatgtataccgatatgacaattttgaaa
gagtccacgccagttgttgaccgtggtattgctttgcacaagcttattagactaattacc
cactctttaggtggtgaagcttatttgaactttgaaggtaacgagtttggtcaccctgaa
tggttggatttccctaacgttaacaacggcgatagttaccattatgctagaaggcagttc
aacttggtggatgaccctttgttgagataccaatacttgtatcagtttgataaggctatg
caaactactgaaaagaattataaatggttgaatacaccacaagcgtatgtctctttgaaa
cacgaagttgacaaggtcatcgcattcgaaagaaatggactcttgttcatcttcaatttc
catccgacagaatccttcacagattatcgtattggagttaatgagccaggttgctaccgt
atcgtattgaactcagacaagcatgaatacggtggctgggatcgtatcgatgagtcccaa
tccaagtattttactactgatttgaaatggaacgaaagaaacaatttcatccaggtttac
attccaaaccgtaccgcattagttctcgcccttgattcaagagtgaggaatggaaattag

DBGET integrated database retrieval system