KEGG   Kluyveromyces lactis: KLLA0B00451gHelp
Entry
KLLA0B00451g      CDS       T01025                                 

Definition
(RefSeq) hypothetical protein
Organism
kla  Kluyveromyces lactis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 Herpes_ori_bp Asp_decarbox
Motif
Other DBs
NCBI-GeneID: 2896875
NCBI-ProteinID: XP_451550
UniProt: Q6CWY9
Position
B:complement(31822..32982)
Genome map
AA seq 386 aa AA seqDB search
MFRKAIAIGGISLRRTFASSMIRKANQPGMMKAMVYYGANDLRFEDRAIPKIIDQRDAII
KMTNTSICGTDVGIWKGKSPEIEEIAVKNEGSFNGRVLGHEGTGIVTEVGDAVRNIKKGD
KVIISCITRCGTCENCARGMYAHCMNDGGWALGYSIDGTQAEYVRTPFADTSLYALPEGL
SDENAVLLSDALPTAHEIGVQMGNVKPGDSVAILGAGPVGMGCVLTSQLYSPSLLIVVDM
DDNRLEMAKEMGATHTINSGKEDAVAKILEITNGRGVDCAMEAVGAQPTWDICQQIIKEG
GHLANVGVHGKPVDFAIDKLWIKNLTITSGLVNTNTTSMLMKNCCSGKLQSDKLVSHHCN
FKDMANNYNIFKHAAKEKALKLLISF
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgtttcgtaaagcaattgccattggaggtatctccttaagacgtacttttgcctcaagt
atgattaggaaggctaatcagccaggaatgatgaaggccatggtttattatggggctaat
gacttaagatttgaagacagagcgatcccaaaaattattgaccaaagggatgccattatc
aagatgaccaacacatcgatttgtggtacagacgttggtatctggaaaggtaagagtcct
gaaatcgaagagattgccgtcaaaaatgaaggttcattcaatggacgtgtcctaggtcat
gaagggactggtattgtcactgaagttggtgatgcggtgcgtaacatcaagaaaggtgat
aaagtaattatttcttgcattactagatgtggtacttgcgaaaactgtgccagaggtatg
tacgcacactgtatgaatgatggtggttgggctttgggttactcgattgatggtacacag
gctgaatatgttcggactccatttgctgatacctctttgtatgctcttccagaaggatta
tctgatgaaaatgctgtcttgctttccgatgccttgcctactgcccatgaaatcggtgtt
caaatgggaaatgtcaaacccggtgactctgtggcaattttaggggccggtccagttggt
atgggatgtgtgttgacttctcaattgtactctccaagcctgttaattgtcgttgacatg
gacgacaaccgtttggaaatggcaaaggaaatgggagctacacataccatcaactcagga
aaagaggatgctgtcgctaagatcttggaaatcacaaatggacgtggtgttgactgtgct
atggaagctgtgggtgctcaaccaacttgggacatctgccaacaaattattaaggaaggg
ggtcacttggcaaacgtgggtgtgcatgggaaacctgttgactttgcaattgacaagtta
tggattaaaaatttgactattaccagcggtcttgttaacaccaataccacatcaatgcta
atgaagaattgttgttctggtaagttgcaatctgacaaacttgtcagccatcattgtaac
tttaaggacatggcaaacaattataacatattcaaacatgctgctaaggaaaaggctttg
aaacttctaatctctttttaa

DBGET integrated database retrieval system