KEGG   Kluyveromyces lactis: KLLA0B00451gHelp
Entry
KLLA0B00451g      CDS       T01025                                 

Definition
(RefSeq) hypothetical protein
Organism
kla  Kluyveromyces lactis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
B:complement(31822..32982)
Genome map
AA seq 386 aa AA seqDB search
MFRKAIAIGGISLRRTFASSMIRKANQPGMMKAMVYYGANDLRFEDRAIPKIIDQRDAII
KMTNTSICGTDVGIWKGKSPEIEEIAVKNEGSFNGRVLGHEGTGIVTEVGDAVRNIKKGD
KVIISCITRCGTCENCARGMYAHCMNDGGWALGYSIDGTQAEYVRTPFADTSLYALPEGL
SDENAVLLSDALPTAHEIGVQMGNVKPGDSVAILGAGPVGMGCVLTSQLYSPSLLIVVDM
DDNRLEMAKEMGATHTINSGKEDAVAKILEITNGRGVDCAMEAVGAQPTWDICQQIIKEG
GHLANVGVHGKPVDFAIDKLWIKNLTITSGLVNTNTTSMLMKNCCSGKLQSDKLVSHHCN
FKDMANNYNIFKHAAKEKALKLLISF
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgtttcgtaaagcaattgccattggaggtatctccttaagacgtacttttgcctcaagt
atgattaggaaggctaatcagccaggaatgatgaaggccatggtttattatggggctaat
gacttaagatttgaagacagagcgatcccaaaaattattgaccaaagggatgccattatc
aagatgaccaacacatcgatttgtggtacagacgttggtatctggaaaggtaagagtcct
gaaatcgaagagattgccgtcaaaaatgaaggttcattcaatggacgtgtcctaggtcat
gaagggactggtattgtcactgaagttggtgatgcggtgcgtaacatcaagaaaggtgat
aaagtaattatttcttgcattactagatgtggtacttgcgaaaactgtgccagaggtatg
tacgcacactgtatgaatgatggtggttgggctttgggttactcgattgatggtacacag
gctgaatatgttcggactccatttgctgatacctctttgtatgctcttccagaaggatta
tctgatgaaaatgctgtcttgctttccgatgccttgcctactgcccatgaaatcggtgtt
caaatgggaaatgtcaaacccggtgactctgtggcaattttaggggccggtccagttggt
atgggatgtgtgttgacttctcaattgtactctccaagcctgttaattgtcgttgacatg
gacgacaaccgtttggaaatggcaaaggaaatgggagctacacataccatcaactcagga
aaagaggatgctgtcgctaagatcttggaaatcacaaatggacgtggtgttgactgtgct
atggaagctgtgggtgctcaaccaacttgggacatctgccaacaaattattaaggaaggg
ggtcacttggcaaacgtgggtgtgcatgggaaacctgttgactttgcaattgacaagtta
tggattaaaaatttgactattaccagcggtcttgttaacaccaataccacatcaatgcta
atgaagaattgttgttctggtaagttgcaatctgacaaacttgtcagccatcattgtaac
tttaaggacatggcaaacaattataacatattcaaacatgctgctaaggaaaaggctttg
aaacttctaatctctttttaa

DBGET integrated database retrieval system