KEGG   Kluyveromyces lactis: KLLA0B01694gHelp
Entry
KLLA0B01694g      CDS       T01025                                 

Definition
hypothetical protein
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
kla  Kluyveromyces lactis
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:kla00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    KLLA0B01694g
Enzymes [BR:kla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     KLLA0B01694g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
B:complement(135778..136356)
Genome map
AA seq 192 aa AA seqDB search
MSRPIVISGPSGTGKSTLLKKLFAEYPTSFGFSVSSTTRQPRNGEVNGKDYNFVTVDEFK
SMIDNKKFIEWAQFSGNYYGTTIESVKEVTNSGKTCILDIDMQGVKSVKQTDLNARFLFV
APPSVEVLKERLTGRGTETPESLEKRLNAAIAELEYAETGAHDLTVVNDDLDAAYEKLKQ
FIFEEENKSGND
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgagtcgtcctatagtcatttctggtccaagtggtaccggtaagtccactcttttgaag
aagttgttcgcggagtacccaacgagtttcgggttctctgtatcgtctactactagacag
ccaagaaatggtgaagtgaacggtaaggactacaatttcgttacagtggacgagttcaaa
tcgatgatagataacaagaagttcatcgaatgggcacagttctctggtaactactacgga
acgactatcgagtctgtgaaggaggtgacaaacagcggcaagacgtgtatcttggacatt
gacatgcaaggtgtgaaatctgtgaaacagaccgatttgaacgctaggttccttttcgtg
gctccaccttctgttgaagtgctgaaggaaaggttgactggcagaggcaccgagacgcca
gaatctcttgagaaaagactaaatgcagccattgccgaattggaatatgctgagactggc
gcacatgacttgaccgttgtcaacgacgatttggatgccgcatacgagaaattgaaacaa
ttcatcttcgaggaagagaacaagagtggaaatgattga

DBGET integrated database retrieval system