KEGG   Kluyveromyces lactis: KLLA0B05225gHelp
Entry
KLLA0B05225g      CDS       T01025                                 

Definition
hypothetical protein
Orthology
K14676  
lysophospholipid hydrolase [EC:3.1.1.5]
Organism
kla  Kluyveromyces lactis
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:kla00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    KLLA0B05225g
Enzymes [BR:kla01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     KLLA0B05225g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
B:complement(470465..474790)
Genome map
AA seq 1441 aa AA seqDB search
MWLTSYVLPRLKNILLLQFHITLPLNYLVLLLLSTVIITYLFLRTRILSNYSQLKDDVSD
ENNINRKDYMDASSASFLLNREKHKGFTSYLDEFLSAIKIFGYLEKPVFHELTKSMKTEK
LQEGEIVLLDDSVGFTIVVEGTLEILHKMDNRHSNPSGDAAANATAFEPPSNDDGYLING
EKFQLLNIVKTGNPLSSLVSIMKLFSNRSTHLNEGTHPSTTNNTPGPGSPNLTGEINSFL
DSTLPAKFGSADSANGNHPISPMELESTFDNLSEASENDRSAKIPDIIARAASDCTIAII
PSSSFQRLLVKYPRSASHIIQMILTKLYRVTFKTAHTYLGLTNEIIFTEFQSINKDNLKL
PEYFRRSIISYFTNRQDDTGSSASTIQKRPQLHRRDSNNSLNYGSRHVVLNSRDQYNPGD
LLSNVPLPRLNPQQRNDLSNTNSSSTLSRADYRPIILNNFSSSQFEETEVSSWRLALVEI
IFQQLGITKDTIEPPISDDFSLHDHSLDEKGLVRRSSYSSFTSLSSSIATHSSNHLVTFL
PRESQQFSRLNRTGGKMASHSKRLNGSSRSNSRTDRSESFDHFRNENLGGDNQFSDFESV
KEDFSKCIKILKFEEGETILCQNSNPQGIYYLVSGEVDVISETKDGNTDESYERTLYTAT
EGYILGYLSSILGCKSLVTLKVSKGPAYLGLIPYNDLERLCDKYFMIYLKLSEILTNSLS
PNLLRLDYFLEWIQLDSSETLFNQGDPANGVYLVLNGRLRQLFYEDADSDIVTQMAELSK
GESFGEVEVLTAIHRLNTVVAIRDTELARIPRTLFEFLAVEHPSIMIHVSRMVAKKAMLM
NFKSGIGFSGSQPITKLIGDETAMQKRYDFNLNIKSNKSSKKNELISNTVNYKTLTLLPI
TEGLPVEEFAYKLINALRQCGKTTIGLNQRTTLSHLGRHAFNKLSKLKQSGYFAELEELY
EIVVYIADTPVSSSWTQTCISQGDCILLLADATCDPKIGEFERLLLKSKTTARTDLILLH
PERYVVPGSTSKWLKNRMWIQSHHHIQFTPMEKVAEPDPIPNIKPLSQLVEKFKENTKKT
QENFVKFLPDSIKTTVETLSGKYIDPKPNPKFYTSVDPIKNDFLRLARTLSGQAVGLVLG
GGGARGLSHLGIIKALEEQGIPIDIIGGTSIGSFVGGLYAMDYDLVPIYGRVKKFAGRVG
SLWRMLSDLTWPVTSYTTGHEFNRGIWKSFRDYRIEDFWISYYCNSTNITESVQEIHSSG
FAWRYIRASMSLAGLLPPIVDNGNMLLDGGYVDNLPVTEMTQRGCKIVFAVDVGSVDDRT
PMSYGDSLNGFWIVLNRWNPFSKHPNIPNMAEIQMRLGYVASVNALERAKSTPGVVYIRP
PIENYATLDFGKFEEIYQVGYAYGHDFLQHLQEKNELPPIAGTTTSAYADKENMLQRRNS
I
NT seq 4326 nt NT seq  +upstreamnt  +downstreamnt
atgtggctaacttcctatgtgttaccaagattgaagaatattttgctcttgcaattccat
ataacgctaccactaaactacttggttttactgctgttaagtacagttatcatcacctac
ctgtttcttcgtacaagaattttgtccaattattctcaattgaaggatgatgtctctgat
gagaataatatcaacaggaaagactacatggatgcttcttctgcttccttcctgttaaat
cgtgaaaaacataagggattcacatcttacttggacgaattcttatcagcaataaagatc
tttggatatttggagaagcctgtctttcatgaattaactaagtctatgaagactgaaaag
ctacaagaaggagaaatcgttttattggatgattctgttgggtttacgatcgtcgtagag
ggaactctagaaattcttcacaaaatggataatcgccattccaatccatcaggtgatgca
gcagcaaatgcaacggcttttgaacctccttcaaatgacgatggataccttatcaatggt
gaaaagttccagttattgaatatcgtgaaaactggtaacccattatcgtccttggtaagc
atcatgaagctcttctcgaaccgctcaacacatctaaatgaaggtactcacccttcaaca
acaaataacactccaggacctggttctcccaacctcactggtgagattaacagcttctta
gactccacattacctgcaaaattcggatctgcagatagtgcaaatggcaatcacccaata
tcccccatggaactagaatcaacgtttgataatctatcagaggcatcggagaatgatcgc
tcggcgaagataccagacattatagctcgtgcagcgagtgattgtaccattgcgattata
ccttcgtcatctttccaacgtcttttagtgaaatatcctagatctgcctcacatattatc
cagatgattttaacaaaactatacagagttactttcaaaactgctcatacctacctaggt
ctcaccaatgagattatttttactgaatttcagtctattaacaaggacaacctgaaatta
ccagagtacttccgcagatctatcatcagctatttcacaaacagacaagatgacacagga
agttcagcctccactatacaaaaaaggccgcagctacacaggcgagattccaataactca
ctaaattacggctcaaggcatgttgtattgaattccagggatcaatacaatcccggtgac
cttctctctaatgtacccttaccaagattgaatccacagcagagaaatgatctctcaaat
accaattcttcctctaccttgagccgtgcggattatagaccgatcatattaaataacttt
tcgtcatcacagtttgaagagacagaagtctcttcttggagattggcattagttgaaata
attttccagcagttgggaataacaaaggatacaatcgagcccccaatttcagatgacttt
tcgctccatgatcattcgttagatgaaaaagggttggtcagaaggtcatcctactcttca
tttacatccctatcttcatctatcgcgacccactccagcaatcacctagtaacatttttg
cctcgagagtcgcaacaattttcaagattgaacagaaccggcggtaaaatggcttcacat
agtaagagattgaacggctctagtagatcgaactcacgtacagacagatcagaatctttt
gaccactttagaaatgagaatctgggtggcgataatcaattttcggattttgaatcagtt
aaagaagatttctctaaatgcataaagattctcaaatttgaggaaggagaaactatactc
tgccaaaattctaatccgcaaggtatttattatcttgtaagcggagaagttgatgtcata
tctgagactaaagacggcaacacagatgagagttatgaaagaactctatacactgccaca
gaaggttacatccttggatatctatcgtccatcctaggttgtaagtcgcttgtgacgctc
aaagtaagcaaaggtccagcttatctagggttaattccttataatgatttggagcgttta
tgtgataaatatttcatgatctacttaaagttgtctgaaattttgactaattccttgagt
cccaatttgttgcggttggactatttccttgaatggattcaactagattcttctgaaacg
ttattcaaccaaggtgatcctgctaatggtgtttacctagtattgaatggtagactaagg
cagctattctatgaagatgcagactcggacattgtaactcaaatggcggaattatcaaaa
ggagaaagttttggagaagtggaagtgttgactgccattcatagactaaacacagtggta
gccattagagatactgagttggctagaatccctcgtacattgtttgagttcttggctgtc
gaacacccttctatcatgattcatgtcagtagaatggtggccaaaaaagcaatgctaatg
aattttaaatctggtataggcttctccggttcacaaccgatcactaagctaattggagat
gaaacagcgatgcaaaaaaggtatgactttaatcttaacataaaatccaataaatcctct
aagaagaacgagcttataagtaataccgtaaattataagactttgacgcttttaccgatt
actgagggtctaccagtagaggaatttgcttataaattgatcaatgcattaaggcagtgc
ggaaagacaacaattgggttgaaccaacgtacgacattatctcaccttggtcgtcatgcg
ttcaataaactttcaaaattgaaacagagtggatatttcgcagaactcgaagagctttac
gaaatcgttgtgtacatcgcagatactcctgtaagctcatcatggacacaaacgtgcatt
tcacaaggtgactgtatcttactcttggctgatgcaacatgtgacccgaagattggtgaa
tttgaaaggcttttgttgaaaagtaaaactacagctagaacggatctaattttacttcat
cccgagcgatacgtggttccaggctcgacatctaaatggttaaaaaatcgaatgtggatt
cagtcccatcaccatatacagtttaccccaatggaaaaggtagcagagcccgatccaata
ccaaatataaaaccgctatcccaattagtcgagaagttcaaggagaatacaaaaaagaca
caagagaactttgtaaagtttttaccagattcaatcaaaaccactgtggaaacattatct
ggaaaatacatcgatcctaaacctaatccaaaattctacacttcagttgatcctatcaag
aatgatttcctaagactagctagaactctttcaggccaagctgttggtctagttcttggt
ggaggaggggcacgtggattaagtcatcttggtatcattaaggctctagaggagcaagga
attccaattgatataatcggaggaacgtcaattggttcgttcgttggaggtttatatgcc
atggactacgatcttgttcctatatatggccgagtcaagaagttcgctggtagagttggt
tcactatggagaatgctaagtgatttgacttggccagttacatcatacactacaggacat
gagtttaatcgtggtatatggaaatcttttagagactacaggattgaagatttttggatt
tcatattactgtaactcgacgaatattacagagtcagttcaagagattcactcatcaggt
tttgcatggcgttatattagagcttctatgtcacttgcgggccttcttcctccaattgtg
gataacggtaatatgttactagatggaggttatgtcgacaacttaccagtgaccgaaatg
acacagagaggttgtaaaattgtgtttgcagtagacgttggatcagtcgatgataggact
ccaatgtcatacggagactctttgaacggattttggattgttttaaatagatggaatcca
ttttcgaaacaccccaacattcctaatatggcggaaatacaaatgagattaggatatgtt
gcttctgtcaatgccttagaaagggctaaaagtacaccaggtgtggtgtacatcaggcct
cctattgagaactatgcgactttggattttggtaagtttgaagaaatataccaagtaggc
tacgcgtacggtcatgactttttacaacatctgcaagagaaaaacgaattaccgccaatt
gcgggtaccacaacttctgcttatgccgacaaagaaaacatgttacaaagacggaacagt
atataa

DBGET integrated database retrieval system