KEGG   Kluyveromyces lactis: KLLA0B07557gHelp
Entry
KLLA0B07557g      CDS       T01025                                 

Definition
hypothetical protein
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
kla  Kluyveromyces lactis
Brite
Enzymes [BR:kla01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     KLLA0B07557g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
B:657789..658829
Genome map
AA seq 346 aa AA seqDB search
MSTTFGNVFRRVNVKTLSFIVGAGALAGSATGTVMEYQDMRNYNNRNYNKQKLAALAAAH
VAAKEKYDVAKYQKVYNDIALKIRDEDEYDDFIGYGPVLVRLAWHCAGTWDAKDNTGGPY
GGTYRFAMETNDPSNNGLQNAAKFLEPIHEKYPWLSHGDLYSLAGVTAIQEMQGPTIPWR
SGRVDQPEDTTPENGRLPDASKDAKYVRCFFHRLNFEDRQVVALLGAHALGKTHLKNSGF
EGPWGAATNIFTNEFYNNLLNEKWDLITNDAGNKQYVNDKGWMMLPTDMALVQDPKYLPI
VKEFANDQDTFFKEFTKAFVVLLENGIDFPQENKPIKFKTLDAQDL
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgtcaacaactttcggtaatgtgttcagacgtgtcaacgtcaagacgttgtcatttata
gtcggtgccggtgctcttgccggttctgccactggtacagtgatggaatatcaagatatg
aggaattacaacaatcgtaattataacaaacaaaaattggctgcgttagcagctgctcat
gtcgcagcaaaggagaaatacgacgttgccaagtatcaaaaagtttacaacgatattgcg
ctcaagataagggacgaagacgaatacgacgactttatcggttacggacctgtgttagta
cgtttagcatggcactgtgctggtacttgggatgcaaaggataacaccggtggtccttac
ggtggtacttacagattcgcgatggagaccaacgatccgtccaacaatgggttgcaaaac
gctgcgaagttcttggaaccaatccacgagaagtacccttggttatctcatggtgattta
tatagtttggctggcgttacggcgattcaagagatgcaaggtcccacaattccttggaga
tctggtcgtgtggaccaacctgaggatactactccagaaaacggtagattacctgatgct
tctaaagatgcgaaatacgtgagatgcttcttccacagactaaacttcgaagatagacaa
gtagttgcattgttgggtgcgcatgctttgggtaagacacatttgaagaactctggcttc
gaaggcccatggggtgctgccaccaatatcttcaccaatgaattctacaacaacctgcta
aacgaaaaatgggacctcatcactaacgatgccggtaacaaacaatacgtcaacgataag
ggctggatgatgttaccaacagatatggccttggtacaggatccgaaatacttgcctatc
gtgaaagaatttgcaaacgaccaagacacattctttaaagaattcaccaaggcctttgta
gtattacttgaaaacggtattgatttccctcaagaaaacaaacctataaaattcaagacc
cttgatgcccaagacttataa

DBGET integrated database retrieval system