KEGG   Kluyveromyces lactis: KLLA0B10868gHelp
Entry
KLLA0B10868g      CDS       T01025                                 

Definition
(RefSeq) hypothetical protein
  KO
K01953  asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
kla  Kluyveromyces lactis
Pathway
kla00250  Alanine, aspartate and glutamate metabolism
kla01100  Metabolic pathways
kla01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:kla00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    KLLA0B10868g
Enzymes [BR:kla01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     KLLA0B10868g
Peptidases [BR:kla01002]
 Cysteine Peptidases
  Family C44
   KLLA0B10868g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asn_synthase GATase_7 GATase_6 DUF3700 NAD_synthase
Motif
Other DBs
NCBI-GeneID: 2897051
NCBI-ProteinID: XP_452012
UniProt: Q6CVM7
Position
B:complement(951111..952835)
Genome map
AA seq 574 aa AA seqDB search
MCGIFASFRNPDVQAYKPKALQLSKRIRHRGPDWSGNIVKNSTILVHERLAIVGLDSGAQ
PITSEDGSYTLAVNGEIYNHIMLREECASYPFKTLSDCEPIIPLYEKYDIDAPKHLDGMF
AWCLYDSKKDRIIAARDPIGITTLYMGRSSASPKSVWFSSELKCLTDDCDEIIAFPPGHV
YDSETDKLTRYFTPDWLDESRIPTTPVDFKAVRESLEKAVRKRLMAEVPYGVLLSGGLDS
SLIAAIAARETEKTNAELDPVVYDSDPHQLAGLDEQGHLHAAGWSRLHSFAVGLPNAPDL
QAARKVATFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHVESVKRVKNLHLADCLRANKSTMAWGLEAR
VPFLDRDFLQLCMNIDPNDKMIKPAEGKIEKYILRKAFDTTDEPDLKPYLPEEILWRQKE
QFSDGVGYSWIDGLKDAAESTISDEQFAQPKAEWGDDIPTTKEAYWYRLKFDALFPQKTA
ASTVMRWIPKADWGCAEDPSGRYAKIHEQHVDKK
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggtatatttgcttcattcagaaaccctgatgttcaggcttacaaaccaaaagct
ttacaattatccaagagaatcagacaccgtggtccagattggtcaggtaacattgttaag
aactctactattctagttcacgaaagattggctattgtcggattggactctggtgcccaa
ccaatcacttccgaagatggttcttacactttggccgtcaatggtgaaatttacaaccat
atcatgttgagagaagaatgtgcaagctatccattcaagactttgtctgactgtgaacct
atcattccattatacgaaaagtacgatatcgatgctccaaaacacttggatggtatgttc
gcttggtgtttgtacgattctaagaaggatcgtatcatcgctgccagagacccaatcggt
attaccactctttacatgggtagatcctctgcttctccaaagtctgtttggttctccagt
gaactgaaatgtttgaccgatgactgtgatgaaatcattgctttcccaccaggtcacgta
tacgactctgaaactgacaaattgaccagatatttcactcctgactggttggacgaatcc
agaattccaaccaccccagttgactttaaggctgttagagaaagtttggaaaaggctgtt
agaaagagattaatggctgaagttccttacggtgttctattgtccggtggtttggattcc
tctttgattgctgctattgccgcaagagaaacagaaaaaactaatgccgaacttgatcca
gttgtttatgacagtgacccacatcaattggctgggcttgacgaacaaggtcatctacat
gctgctggctggtctagattgcactcattcgctgttggtttgccaaacgctccagattta
caagctgctcgtaaggtggctacattcatcggttctatccatcacgaacatactttcact
ttacaggaaggtctagacgctttggacgatgttatctaccacttagaaacttacgatgtc
actactatccgtgcttccaccccaatgttcttgctttctcgtaagatcaaggctcaaggt
gttaagatggttttgtccggtgaaggttccgatgaaatctttggtggttatctatacttc
gcacaagctccatcagctgctgaattccacgtcgaatctgtcaagagagttaagaacttg
cacttggctgattgtttgcgtgctaacaaatctaccatggcttggggtctagaagctcgt
gttccattcttggacagggacttcctacaactatgtatgaacattgatccaaacgacaag
atgatcaaaccagctgaaggtaagatcgaaaaatacattctaagaaaggcattcgatacc
acggatgaaccagatttgaaaccatacttaccagaagaaatcttgtggagacaaaaggaa
caattctccgacggtgtcggttactcttggattgatggtctaaaggatgcagctgaaagc
actatctctgatgaacaattcgctcaaccaaaggctgaatggggtgacgatattccaact
accaaggaagcctactggtacagattgaagttcgatgctttgttcccacaaaagaccgct
gcttccactgtcatgagatggattccaaaggctgactggggttgtgctgaagatccttcc
ggtagatacgccaagatccacgaacaacacgttgataaaaaataa

DBGET integrated database retrieval system