KEGG   Kluyveromyces lactis: KLLA0B11616gHelp
Entry
KLLA0B11616g      CDS       T01025                                 

Definition
hypothetical protein
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
kla  Kluyveromyces lactis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:kla00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    KLLA0B11616g
Enzymes [BR:kla01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     KLLA0B11616g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
B:complement(1018695..1020305)
Genome map
AA seq 536 aa AA seqDB search
MKPIVGSLPFNARIAVVGGGVSGLTFTYFLSKLRPDVKVTLYEKQDRCGGWIHSDIIDDG
EGNRVMVEKGPRTLRGVSDGSVIIVQTLRDLGKQDVVQYIAADSEANRKFLLDKNNVLTQ
VPDSPISALKFFAGSLGKGFISGILGEPFRSAKVTGTDESAHSFIHRRFGNEHISKNVFS
ALFHGIYAGDIKKLSAKRTIGKMVEMENTSGSLIKSMFNKMIIKYKNRNDTRSHKIEISP
LLKKFAEATGQSEKQLISLSQRLKAFPMVGFRSGLDCYPKTLSEYITGLPNVSVKHEAVE
SVIPGKDGKNVVIVSDSGESTFDHARLTVNPNVLENIIPFEPLAKKLREVHSNTVILVNF
YLPRKDVISNYHGFGYLVPQSNQNHEKLLGVIFDSVIEKNFKPVFGVQNESKSPDDDKRY
TKVTAMLGGHYLNNEGEQNIPSKSIIINSVKYAFMKHLHIDENDLEDGTWEVTVAKDCLP
QYHVGYDDWVQQTAKLVQEQYSNYVSLGGMAFSTGPGVPNVIEDGFESAYVLSKAE
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccaattgtaggttcattaccttttaatgctagaattgcagttgttggtggagga
gtttcggggttgacttttacttatttcttgtccaaattaagaccagatgttaaggtaacg
ctatatgaaaaacaggatagatgtggtgggtggattcattctgacataatagatgatgga
gaaggaaaccgggttatggttgagaaaggtccacgtactttacgaggagtttcggatgga
agcgtcataattgttcagacattgcgagacttaggcaaacaagatgtcgttcaatacatc
gctgcagactccgaagcaaacaggaaatttcttttggataagaataatgttttgactcaa
gttcctgattcacctataagtgctttgaaattctttgctggctctcttggaaagggattc
atatctggtatcttaggtgaaccattcaggtccgctaaggtaactggaacagacgaaagc
gcccacagtttcatccataggaggtttggtaatgaacatatcagcaaaaatgtatttagt
gctttattccatggcatatatgctggggatatcaaaaaactaagtgcaaaacgaacgata
ggaaagatggtcgaaatggaaaacacatctggatctctaatcaaatcaatgtttaacaaa
atgattatcaaatataaaaaccgtaatgatactagatcacacaagatagagatcagtcct
ttacttaaaaagtttgcagaagcgacaggccagagtgagaaacagttaatttctttgtct
caacgattgaaggcttttccaatggtgggattcagatcaggattggattgttatccgaag
acattatctgagtatattacaggattaccaaatgtctctgtcaaacatgaggcagtggaa
tcagttataccggggaaagatggaaagaatgtggttatagtgtctgattccggagaatca
accttcgaccatgctcgtttaactgtaaatcccaatgtactcgagaacattatcccattt
gagccattagcaaagaagcttagagaggttcattcaaacacagttatattagtgaatttc
tatttgccacgcaaggatgtcatttctaactaccatggattcggttatttagtaccacaa
tctaaccaaaaccatgagaaattgctcggtgtcatttttgattccgttatcgaaaagaac
ttcaaacctgtgtttggcgtccaaaacgaatcgaaaagccctgatgatgacaagcgctac
acaaaagttactgctatgctcggaggtcactatctgaataatgagggcgaacagaacatc
ccatcgaaatcgataataataaactctgtgaaatatgcttttatgaaacatttgcacata
gatgaaaacgatttggaagacggaacatgggaagtcacagttgccaaggattgtcttccc
caataccatgttggatacgacgattgggtccaacagacagcgaagttagtacaagaacag
tattcaaactatgtatctcttggaggaatggctttcagtacaggaccaggagtacctaac
gttatagaagatggatttgaaagtgcgtatgtgctatccaaagctgaataa

DBGET integrated database retrieval system